SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000000650 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000000650
Domain Number 1 Region: 572-690
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-22
Family Ankyrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000000650
Sequence length 712
Comment (Tetraodon nigroviridis)
Sequence
MAAGVVSAPLIIASSSSHTHASRREIHTDTLVFIQSADTPGALIFYTLDGSRPEPDQSGS
AARSRKYSKPVRLPAGRVAVRAVAVASDGRRSSTVTKMFVVQRREAGVEEKVPEVNQVSK
QRLGRHGDAGLKLKTAGVLASLQRCSDVPRGGGDPNSVSSLECCWGPLPVDPPHHHGEPA
SLPQKPVHGPPSGPVQGSDPLKQLRSTQTSRLVQDPEVLWDQQVLTARPPDPFSLFFPIC
GAKISHQTFPSRGTEQGHRVCGCCGSGNPVNVSSCLTCESCLQPQREPSSSGCWLASEDL
APWCGVSGPAPSLAAPACCAGAAAPAAILPPPGCASCGVFLRAPTPPTAPPGEEPLHGEV
VTKLDRFHAEAMTGGSQQATPPPDCAWKMLRPPQTDPRRPWGSSTRRPLRGSRAGGRRSP
RRRPPLTSVSPGKGYWRRQLDHVCAHLRSYTQNNAPFRALLGDPCMGQLLSAVVQDDQQQ
LTLTISFALAHQKTQVCGSTCTSSSTTPTQTGLGEGLDLFRSGSCDLPMGVWGEVHPHSH
THTRRGLTGGDVLPGGGASKPGRGRDAQLMMELAPGRGQLSIVQQLLDQGADPACCHSNG
RHPLALAVLNGHHQVLPELVQRGAPVDQQSGPMKNTALHEAAALAPEGLPAAELLLSCGA
SVGVKNASGQTAFQLAADSGCNQMVSLLAAQTGLVLLGKLASPSGNVQLGAN
Download sequence
Identical sequences H3BXD7
99883.ENSTNIP00000000650 ENSTNIP00000000650 ENSTNIP00000000650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]