SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000001136 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000001136
Domain Number 1 Region: 328-500,540-624,656-684,754-872
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.55e-80
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0011
Further Details:      
 
Domain Number 2 Region: 181-289
Classification Level Classification E-value
Superfamily RING/U-box 4.12e-32
Family Zf-UBP 0.00000403
Further Details:      
 
Domain Number 3 Region: 722-770
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000311
Family UBA domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000001136
Sequence length 875
Comment (Tetraodon nigroviridis)
Sequence
ARRYSAACSRNAKMATDLGELLVPYMPTIRVPRTGDRVFKSECAFSFDSPESEGGLYVCM
NTFLGFGREHVERHYRKTGQSVYMHLKRHVKEKATGAAGGAIPRRRNGKVFLDLELNRDF
NGDDYEYEDEAKLVIFPDHFEIPLPNIEELPALVTIACDAVLNAASAYKKQEPESWDEEI
QVSRHARSLRQLDNGVRIPPSGWKCQKCEMRENLWLNLTDGAVLCGKWFFDGSGGNGHAL
EHHRETSYPLAVKLDTITPDGADIYSFEEEEAVLDPHISDHLSHFGIDMLQMQKKTENGH
HRENNSRPRVSEWEVIQESGMKLKAVFGSGYTGIKNLGNTCYLSTVMQVLFSIPDFQRMY
VGNLQRIFDYSPLDPSQDFATQMAKLGHGLLSGQYSKPPMKSELIEQVMNEEHKHQQKGV
SPRMLKALVSRGHPEFSSNRQQDAHEFLLHLINLVERNSAGSENPSDVFRFLVEERIQCC
QSRRVRYSQRVDYCIQLPAPMEAAINREELLAYETKRKEAEENIQPLPEPVRARIPFTAC
LQAFTEPENVPDFWSSALQAKSAGVKTSRFASFPEYLILQIKKFTFGVDWVPKKLDLAID
VPDFLDLSLRATGLQAGEEELPDLMPPIVLPEDTRDDPVYEQLKDPEAPEIDEAAVMQLA
EMGFPLEACRKAVYYTGNMGPEMAFNWIIAHMEEPDFAEPLTLPSMMDSGPSTSDSVMGA
TPLDPNSPPEESIAILTSMGFPRPHSISALKATNNNLERALDWIFTHPEPEESEALSDMA
DTEPNDNGFSNANSHSDATLSPDRDTTGPRIKDGPGRYELFAFISHMGESTMSGHYVCHI
KKEGRWVIYNDHKVCLSERPPKDLGYIYFYHRLSS
Download sequence
Identical sequences H3BYS0
99883.ENSTNIP00000001136 ENSTNIP00000001136 ENSTNIP00000001136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]