SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000001542 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000001542
Domain Number 1 Region: 501-675,885-1024
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.22e-53
Family Regulator of chromosome condensation RCC1 0.012
Further Details:      
 
Domain Number 2 Region: 3692-3882
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.44e-26
Family APC10-like 0.015
Further Details:      
 
Domain Number 3 Region: 2223-2267,2348-2390
Classification Level Classification E-value
Superfamily E set domains 0.000000012
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Domain Number 4 Region: 4433-4508
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000205
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000001542
Domain Number - Region: 3350-3439,3646-3718,4011-4076
Classification Level Classification E-value
Superfamily ARM repeat 0.012
Family HEAT repeat 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000001542
Sequence length 4685
Comment (Tetraodon nigroviridis)
Sequence
FSGAGADLCTTGTGMGSCPTPGAQSDCRTRYQLLLSGRALADKYRRIYTSAINDKEQGIN
QDVEGHQPIPRGKKALSKKKLKRRQKVKSKVKSRTKAECLDGALFVPDIKLHSNPSAFNV
YCNVRHCVLDWQQREASLALASRSSVQSGDSDSEEEEEFREPAVKLPKIIGIGLCGVFEL
IKETRFSHPSLCLRSLQALLDMLQGQQPEGFQTEPPDVLESLFQLLLETTVRSTGPNDPT
GQAITALSCACLFSLVVAWGDTGKILQAVSAILTNNGSHACQTIQVPTILNALQRSVQAV
LVGKIQIQDWFGNGIKRAALMNKWVLKEVAIDDDEHCLLQTDGSFLYLLCNDGLYKVGSG
YSGTVRGHVYNSTSRVRNRTEKRSWLGFAQGYLLYRDTSNHTMTAIKINPETLDPEGTVI
MPGQHGQDGQNIIFTDGEYINQIAACKDDGFVVRIYTMSSDPALQQELQLKLARKCLHAC
GISLFDLEKDLHIISTGFDEEAALIGAGREFALMKTASGKIYYTLNYHILFIIFGGPSAW
KLVEFPFTKSPNITHFXSVFFTGSASKGEDGESTKSRRQPKPYPKKMIKLETKTAVYTAC
NNGSSSIVTKDGELYMFGKDAIYSDSTCQVTDLKGHCVTQVAMGKAHTCVLTKNGEVWTF
GVNNKGQCGRDTGSMSQAGKAFGVESMATAMDEDLEDELEEKEEKSMMCQPGMHKWKLDQ
CMVCTVCGDCTGYGASCVSSGRPDRVPGGICGCGSGESGCSVCGCCKACARELDGQEARQ
RGIFDAVKEMIPLDLLLAVPVPPPPGVNIEEHIQIRQEEKRQRINRRHRLEEGRGPLVFP
GPIFMNQREQALARIRPLQALRHKRDKQKDGSSERGEKDASKITTYPPGAVRFDCELRAV
QVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGSPTLVQALPGPSVQVTAGSNHT
AVLLIDGQVFTFGSFSKGQLGRPILDMPYWNAKPSPMPNIGAKYGRKATWIGASGDQTFL
RIDEALINSHVLATSEIFASKHIIGLVPSFVSESPPFKCLLINKMDGSCRTFNDSEQEDL
QGFGLCLDPVYDVIWRFLPATREMLCYNAVIADARMSSATDLQARCSILSPELALPSGSH
ATTTRSHGALHILGCLDTLAAMQELKMGVASAEEETQAVMKVFSKEDYSVVNRFESHGGG
WGYSAHSVEAIRFCADADILLGGLGLFGGRGEYTAKIKLFELGPDGGDHETDGDLLAETD
VLAYDCAAREKYAMMFDEPVLLQLGWWYVAWARVSGPSSDCGSHGQATITTDDGVVFQFK
SSKKSNNGTDVNAGQIPQLLYRLPSNDGNASKGKQQTSEPVHILKRSFARTVSVVKECFD
SLLSILHWSWTTLVLGVEELRGLKGFQYTATLLDLERLRFVGTCCLRLLRVYICEIFPIA
ASTKAVVEESSKLAECVGKTRSLLKKILSEGMDNCLTRLDNDPQGYLSQPLTLLEAVLQE
CHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIAEANFRTSSSRLLAAVMSALCNTSVK
LTSILPIAYDGEVLLRSLVKQVSTENDSALAHRFPLLVAHMEKLSHTEENLMGMTSFREV
LEKMLVIVVLPVRKSLRKEVELFSPHLVSNTCGLLASIVSELTASALGSEVDGLNSLHSV
KTSPNRFTKTSQGRSWNTGNGSPDAICLTVDKPGVVLVGVCVYGGGGIHEYELEVLADDT
EHPGDSAHSHRWTSLELVKGTYSTDDSPSDISEIRLDKAVPLKEGVKYAVRLRNYGSRTA
NGDGGMTTIQCSDGVSFTFSTCSLSSNGTNQTRGQIPQILYYRSEYDGDLQSQLVSKANE
EDKNCSRALSVVNAVVRAAKDLLHRAFAVDVDDIPELLSSSSLFSMLLPLILAYIGPVAA
SVPKAAVEVFVLVQDLLPAVSALNQKYAPPTFNPNQSTDSTTGNQPEQGLSACTTSNHYS
VIESDHPYKQASVTQYRVSFPDCVRWTTIEFDPQCGTAQPEDVLRLLIPNRTLHLSSLGG
KPLIHDTINTWTELRKFSGSTGWPTSVLVLPGNELLFSLETASDYVKDEKACFYGFKCVA
VGYEFNPGPDEGLIMLEKELAYLGSVCAAALMKKDLALPIGNELEEDLEILEEASLQVCK
SHSGILGKGLALSHSPTILEALEGNLPLHLQTNEHSFLEDFITCVQNSSGGRLARWLQPD
SYADPQKTSLILNKDDIRCGWPATVVVQTKDQYGDVVHVPNMKVEVKAVPVSQKKSVQPD
NIKKLQRLPGNSSPSSSGPDLTFGGLPTPKLEATYEPVIVKEARYIAITMMKAYENYSFE
ELRFASPTPKRPSENMLIRANTDGTYSANWTPGAVGLYTIHVTIDGIEIDAGLEVEVKDP
PKGMIPPGTQMVKPKAEPQPSKVRKFVSKDSAGLRVRSHPSLQSDQIGVVHVNGTITFID
EIHNDDGVWLRLNDETVKKYVPSMNGYTEAWCLSFNQHLGRTLLVPADSVFNASQGVRDL
GFWTPITVFPPQELKGQSEDSIKEVSSCPSHEAPIRVRDRAGQGGGPGSYQVVKTGPSGH
NIRSCPNLRGIPIGMLVLGNKVKAIGEVVNSEGSWVQLDKNSVVEFCESDEGEAWSLARD
RGGNQYLRHDEEQVLVEHGAQTPPPSPFSVPAFNRPATSNGAQGFDYGLSNNKGDRLSAI
LNSIQSRPFLPAAPSSSVFEQAAHVHSPFVFGQSPSQLSQPQPQLLSDRGNTTSGTRPMS
PASKHRQENRLPKQESRGIRSSDQTRVKTGDGGLSAGEALILRSDTAKLRSDSHSRSHSP
NHNTLQALKADGRTPGLRTDSPNSSSRSSSPKQKMVSSSGRSSPSSTSSQNPPSTHYDKN
LQAKISPSSKALLDPPRERSKSDSYTLDPDTLRKKKIPLTEPLRGRSTSPKPKLSPKDPN
KGAITNVENRVPSPHVTQENLHSEVVEVCTSSALLSNEDCNDENVEVHNAEDGSCKVHFS
IGKAPVKEEVESRSSPKVSRKTSSRHTRPKKDKSGPLFKGESTSRVTEPVKQAMSPSVAE
CARAVFAAFLWHEGIVHDAMACSSFLKFNPDLTKEHAPIRSSLGGQGSEEKESKLKNRHS
LEISSALNMFNIAPHGPDISKMGSINKNKVLSMLKEPPLPEKCEDGKGEAISYETTSHSS
MRAKSILPLTLQHLVAFWEDISMATIKAATQNMIFPSPGSSAIPEVRPRGNLFGEMAQLA
MGGPEKDTICELCGESHPYPVTYHMRQAHPGCGRYAGGQGYNSIGHFCGGWAGNCGDGGI
GGSTWYLVCDRCREKYLREKQTAAREKVKQSRKKPLQVKTPRALPTMEAHQVIRANALFL
LSLSSAAEPSMLCHHPPRPLHSQLLPSLKEGVSDEPPNKMGCLYLQTLARQHTENFGAYP
DDNLFQDEMRYLRSTSVPAPYISVTPDACPNVFEEPESNMKSMPPSLETSPITDSDTAKR
TVFQRSYSVVASEYDKQHSPSPARVKAVPRRRVHSGDAEVGSSLLRHPSPELSRLISAHG
SLSKGERNFQWPVLAFVIQHHDLEGLEVAMRHALRKSACRVFAMEAFNWLLCNVIQTTCL
HDILWHFVASLTPSPFEPEDEEDEENKGNKEIVEQERDLGVCEHPLSDIVIAGEAAHPLP
HTFHRLLQTISDLMMSLPSGSSLQQMALRCWSLKFKPSDHQFLHQSNVFHHINNILSKSD
DGDSEESFNISVQSGYEAMSQDLCMVTCLKDLTSVVDIRTSSRPAMIGSLTDGSTETFWE
SGDEDKNKTKSITINCVKGINASNVSVHVDNSRDLGNKVTSVAFLCGKAIEDLCRIKQVD
LDSRHMGWVTSELPGGDYHVIKVELKGPENTLRVRQVKVLGWKDGESIKILGQISASMAQ
QKNCEAETLRVFRLITSQVFGKLICGDAEPTPEQEEKNLLSSPEGEDKVPSDADLKEHMV
GIIFSRSKLTNLQKQVCAHIVQAIRMEATRVREEWEHAISSKENANSQPSDDDASSDAYC
FELLSMVLALSGSNVGRQYLAQQLTLMQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPVR
LASIIGVKALPPADISDIIHSTEKGDWNKLCILDMFLGCIAKALTVQLKAKGTTISGTAG
MAAGKGVTTVTLPMIFNSSYIRRGESHWWMKGSTPPQIAEIIIKLVKDMAAGHLSEAWSR
VTKNAIAETIIALTKMEEEHRSPVRCIATTRLWLALASLCVLDQDHVDRLSSGRWMGKDG
QQKQMPMCDNHDDGETAAIILCNMCGNLCTDCDRFLHLHRRTRSHQRQVFKEEEEAIKVD
LHEGCGRTKLFWLMALADSKTMKAMVEFREHTGKPTSSSSDACRFCGTRNGTELSAVGSV
CSDPDCQEYAKQACSKTHPCGHPCGGVKNEETCLPCLHGCDKSTGCLKQDADDMCMICFT
EALSAAPAVQLDCTHVFHLQCTRRVLENRWLGPRITFGFMLCPICKNKINHSVIKDLLDP
IKELYEDVRRKALMRLEYEGLHKSEAITTPGARFHNDPAGFAMNRYAYYVCYKCKKAYFG
GEARCDAEAGQGDDYDPSELICGACSDVSRAQMCSKHGTDFLEYKCRYCCSVAVFFCFGT
THFCNACHDDFQRMTSVPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCR
NAHTF
Download sequence
Identical sequences H3BZX6
ENSTNIP00000004483 99883.ENSTNIP00000001542 ENSTNIP00000001542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]