SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000001883 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000001883
Domain Number 1 Region: 1201-1370
Classification Level Classification E-value
Superfamily C-type lectin-like 4.39e-66
Family Endostatin 0.00000198
Further Details:      
 
Domain Number 2 Region: 119-309
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-25
Family Laminin G-like module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000001883
Sequence length 1375
Comment (Tetraodon nigroviridis)
Sequence
TMTNATKEEEEEDDLSGMGEAIPDLGSGIREFIRAWNAGRNASGAVGKAHPNSTGNANTL
TVLASRFLLIGPFARASTLGLSPCPTSSTTPLWTRWEGPTNGPAALPPPSLGRAQSGVSL
LQLMGGSPAAPGARGGGPSYRFSGAAVAGQPALAHVPSPFYRHFSLVFNVRPSSPDAAVL
FAITDQPQRLVYVGVKLGAERAGRQAVQFFYTEPDSDASYQAAVFAVPSLANSWTFALSV
FEDQVTFYHGCEAAPQAVRFERSPDPMELDPGARVFVGQAGQADAHRFRGDMAELRLVGD
PQAAERLCDDEDDSDAASGDFGSGDGGVGVQTGYTLKPVPAPPLTASQKPTGKGSEGEGP
GQGLGEGPGGALLHRRCCTSACIQRFSGRKRLEGEGSSGFGFPGKKGDPGVPGPPGLPGP
PGPAAEVVRLEDGSIVQHVPGPAGPPGSPGLLGRAGPPGSDGLPGVPGGDGKEGPPGPQG
APGTPGSPGAKGQKGDPGEGQPGPRGPPGPPGPPGPGAADRQALTFLDMEGSGLADLDRI
RGAQGPLGLPGPPGILGTLVALGPNGTIVLGPPGLPGLDGSTGLLPFFLFQGPPGPPGPP
GQPGLVGVKGDSGGRGLPGLPGEQGARGDPGRMGSPGQTGLAGLPGPMGPTGPPGPPGPP
YRGGLGLRDQLDSTTGLPGFTGPPGPQGPPGVAGFPGKAGLPGSNGEKGSEGPRGPPGIP
GISGFPGQPGEKGDRGQRGERGPPGRDSGLPGPPGPPGPPGQIVYQPTNDGGSRTGGRLP
GRPGLPGPAGPKGDRGDSGPPGFAPKGQKGEPGIILDPHGTPLYLRGLGESGPPGPVGPP
GPIGPPGQKGEIGLPGRPGRPGLNGAKGVKGDSGSGPGFGYPGPPGPPGPPGPPGASGAF
DRITVSRSGLESSGWFWRQPASLKGEKGDPGPAGRVEVSAVQPVYDQTEMKGETGSPGLK
GEKGEPGGGYYDPRFGGSGSPGQPGPPGPKGDSIVGPPGPQGQPGQPGRGYDGRPGLPGP
PGPPGPPGGSNLGGSWDTPVSPGPPGPPGAPGLPGRSSGVTVFRTYDTMATAARRQPEGS
LVYVMDQTDLYLRVRDGLRQVYLGSYVALPEDDNQVAVEPPPVVLYSPDSDAGPSQPEGP
AQPPHPPTRHGPGDPHSQHPAHPDPRYHPERPTHPYQRYPLTTPRRPAAPESPAHRHASG
PALHLIALNGPQTGAMQGIRGADFLCFTQAQAIGMKGTFRAFLSSRLQDLHSIVRRTDRE
RIPIVNLKDEVLFDSWDAIFTQGGLKEGVPIYSFDGRDLLGDAAWPEKMLWHGSTGGGQR
HTQGFCEAWRSGEQSQSGMAAPLHSGSSLLQQHPGSCSSSYAVLCIENSYVGQAR
Download sequence
Identical sequences H3C0W7
ENSTNIP00000001883 ENSTNIP00000001883 99883.ENSTNIP00000001883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]