SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000002610 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000002610
Domain Number 1 Region: 1-74
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000779
Family Laminin G-like module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000002610
Sequence length 131
Comment (Tetraodon nigroviridis)
Sequence
VFVKREGEKISLIVDGINAQAKRIPSGDRSGLISTLYVGGVPPALKVPGSGSFIGCIRDL
LLNQASAGSSTHSQGTVPCYQGPLQPGAYFSGRGGHIIIDQSLVLGRGPRNPDGGSACLC
FWAAVVCWDVT
Download sequence
Identical sequences H3C2Z2
ENSTNIP00000002610 99883.ENSTNIP00000002610 ENSTNIP00000002610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]