SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000002900 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000002900
Domain Number 1 Region: 88-141
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000951
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0038
Further Details:      
 
Domain Number 2 Region: 16-74
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000227
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000002900
Sequence length 183
Comment (Tetraodon nigroviridis)
Sequence
MNYLLVLGTLVAFCESQSIPEFCLLPKNEGKGSTFNFALYYDAAQDLCSPFIYKGEGGNG
NRFANERDCMRNCSSNAEKFYPMDASLACHFKKESGKCGGQLLRFYYDPFNAKCKKFQWT
GCVGNGNRFLTPEICNTTCAGIHGEHKVTHVQFTFSMVVTKLLCFLEHGEQEEEDEPDTP
VGQ
Download sequence
Identical sequences H3C3T1
ENSTNIP00000002900 99883.ENSTNIP00000002900 ENSTNIP00000002900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]