SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000003250 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000003250
Domain Number 1 Region: 324-550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-23
Family Laminin G-like module 0.058
Further Details:      
 
Domain Number 2 Region: 142-251
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000106
Family Cadherin 0.0036
Further Details:      
 
Domain Number 3 Region: 31-146
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000128
Family Cadherin 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000003250
Sequence length 959
Comment (Tetraodon nigroviridis)
Sequence
QRTNKCCCLAGQLRLLCEQGVCGASAPEVSVNKHKPWIETTYHGIVTENDDKVLLDPPLI
ALDKDAPLRYAGEICGFRIHGQNVPFEAVVLDKSTGEGVIRAKDKMDCELQKEHTFTIQA
YDCGEGPDGANMKKSHKATVHIQVNDINEYSPTFKEKTYKATVLEGKKYDSILKVEAVDA
DCSFQFSQICNYEIVTPDVPFTVDKDGFIKNTEKLSYGKERMYKLTVTAYDCGKNRASED
VLVKISVKPTCKPSWQGFSKRIEYEPGTGSLGLFPSVHLETCDEPITSIQANVELETSHI
GKGCDRDTYSEKSLHTLCGASSGTVELLPAPSSSANWTVGLPTDNGHDSDQVFEFNGTQA
IKVPDGLVSTSLKEPFTISVWMRHGPGAHEKETILCNSDKTEMNRHHYSLYVHNCRLILL
LRQEPSEAENYKPAEFHWKLDQVCDKEWHHYVLNVEFPTVALFVDGTMFEPFLVTEDYPL
HASKLETQLTIGACWQDASGHENDSDFSPRLAGKGGNARMAQFFRGNLAGLMIRSGKLEN
KKVIDCLYTCKEGLDVQLPEEVTSAVKVEFNPSQSSLTVEGDDIDAFEKVMQHISYLNSR
QFPTPGIRHLRISTTVKCFNGEPCVAVPDVEGYVMVLQPEEPKISLSGIDHFARSAAEFE
SQEGVTLFPELRIVSTITREVETDSESEVAAGADDDPTVQETVVSEEIMHNLDTCEVTVV
GDQLDGEHESLELDVSQLQQRGLEMSASNLGLVVTAGVNSMANYEQLLHLIRYKNWHTEA
LFDRKFKLVCSELNGRYVSNDFKVEVNVIHTANPVEHANNAMMQPSFINPVHHASVDLSG
HNLVNAHQASVVPSAATVVIVVCVSFLVFMIILGVFRIRAAHQRTMRDQESGKENEMDWD
DSALTITVNPMETYEDQHSNDITSAESESSEDEEGAEREDQQGASRQQQLEWDDSTLTY
Download sequence
Identical sequences H3C4T1
ENSTNIP00000003250 ENSTNIP00000003250 99883.ENSTNIP00000003250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]