SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000003692 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000003692
Domain Number 1 Region: 37-121,169-298,334-449,533-644
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.4e-33
Family LacY-like proton/sugar symporter 0.063
Further Details:      
 
Domain Number 2 Region: 457-509
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000347
Family Ovomucoid domain III-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000003692
Sequence length 665
Comment (Tetraodon nigroviridis)
Sequence
PPSLWGQSNMGAEEPNPTGSQRPARRRSLFNSIKFFVLCHSLLQLAQLLVSGYMKSSIST
IERRYGLSSQKSGMLAAFNEVGNTVLIIFVSFFGSRVHRPRFIGGGALLACLASLLMALP
HFLSGPYEYTDHISHGKASIDNRSAVCQSESNLNIKPTNQSCSQQDNPAQHVAYPLLLLG
QLLLGIGVVPIQPFGISYIDDHASKRNSPLYLGLLLAATAIGPAFGFITGSIMQRFYVDF
DKVSKDHIHLTPKDLRWVGAWWLGFLVASCLIFITALPYFFFPRSMPKESFECKQKQQVL
ARGQGVGEDADDVESSPDCTKQRPDPIQELSLLQFLKSFPHVALRMMRTPIYLLVILAQV
NQAALLAGLATFMAKFIEKQFNRTASLSTMMIGGVCIPLAVVGTVLGGVVMRRLNLSLNG
ASKLCAGAIFVCLFSSLPLLLIGCSTQTVDGVFPPGSGSLSCSASCHCPEEAFNPVCGSN
RVEFRSPCHAGCNNIQFGPHNQPINFTDCKCVGGLGFASPGTCGSGCSHLLLPFMVLLAI
TSFVTSFTQTPSFMMILRTVPAEDKSFAVGVQYMMFRVLAFLPGPVLYGSVIDTTCILWG
KKCGQQTSCLYYNLDQFRSRFLGLMAVFVGGALLSFLLTVRVLHRGAKENASTPGSKGGY
ELVNE
Download sequence
Identical sequences H3C622
ENSTNIP00000003692 99883.ENSTNIP00000003692 ENSTNIP00000000253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]