SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000003946 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000003946
Domain Number 1 Region: 10-166
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 3.01e-60
Family TRADD, N-terminal domain 0.00018
Further Details:      
 
Domain Number 2 Region: 197-290
Classification Level Classification E-value
Superfamily DEATH domain 8.63e-17
Family DEATH domain, DD 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000003946
Sequence length 298
Comment (Tetraodon nigroviridis)
Sequence
MADKTEDGGPWTGCAVLFLRSLSPNVNLLSLYKDHQEGKFTVFKVLKLTLIDSARGLRGY
EILKVHDADPLLGVEVKFVDVAACQQFLSSYGSGALHQSLSQHACRLLALPQELRVETQL
KASTHVLDLCLDDLQCCLKHIHLSQPERLCDEEIDHLEQMLQSQALRPAQQLSSTNQQVE
SPVPNNCFRFQNRVFEDRILTAADVQSFSNGVGRQWKNVGRALGRSCRALKGPAIDNLAY
EYEREGLYEQAYQLLNRFIQAEGRAAKLSRLVRALEDCKLTGLAENVLDIQPVFGALA
Download sequence
Identical sequences H3C6S5
99883.ENSTNIP00000003946 ENSTNIP00000003946 ENSTNIP00000003946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]