SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000004007 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000004007
Domain Number 1 Region: 25-186
Classification Level Classification E-value
Superfamily Lipocalins 8.11e-29
Family Retinol binding protein-like 0.0028
Further Details:      
 
Domain Number 2 Region: 224-278
Classification Level Classification E-value
Superfamily BPTI-like 3.69e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0019
Further Details:      
 
Domain Number 3 Region: 280-335
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000355
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000004007
Sequence length 347
Comment (Tetraodon nigroviridis)
Sequence
RKESVILLVLVSVWTLQAEPVDPEAVTQTQENFDLGKFMGKWYQAAVASTCPCYLKRKSK
NPDMVPMVLQHVDAELNFTKTATSFRNGTCKQMTSHYSLTSTPGRFFHHVSRFGSDVDSF
VVRTDYENVAVMLQLSTEKMSGNRSTNLILYSRKTEVTSDALDDFKKLVEEHGISADTII
VNKNNGTEKALSSVVSEQRYKREAELGLDQPEGSGMDQTFFNGSEACKAAPDTGPCFGSF
QNYFYNSSSMSCELFSYGGCLGNQNNFKDERDCLQRCRTEAVCHLPMLAQPCSGQPPIWA
FDSSAGLCVPYKVGFCQNNANKFYSKAECEEYCGKTQDDGTEFLAAN
Download sequence
Identical sequences H3C6Y6
99883.ENSTNIP00000004007 ENSTNIP00000004007 ENSTNIP00000004007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]