SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000004388 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000004388
Domain Number 1 Region: 3-68
Classification Level Classification E-value
Superfamily E set domains 3.94e-17
Family Filamin repeat (rod domain) 0.0000875
Further Details:      
 
Domain Number 2 Region: 72-122
Classification Level Classification E-value
Superfamily E set domains 0.0000012
Family Filamin repeat (rod domain) 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000004388
Sequence length 123
Comment (Tetraodon nigroviridis)
Sequence
WTREAGAGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIRFNDEHIPDSPFI
VPVASPSDDARRLTVASLQESGLKVNQPASFAVSLNGAKGMIDAKVHSPSGALEECCITE
IDQ
Download sequence
Identical sequences H3C816
ENSTNIP00000004388 ENSTNIP00000004388 99883.ENSTNIP00000004388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]