SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000004682 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000004682
Domain Number 1 Region: 31-146
Classification Level Classification E-value
Superfamily BRCT domain 1.96e-22
Family DNA ligase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000004682
Sequence length 196
Comment (Tetraodon nigroviridis)
Sequence
QVIQACGGSVDSTLTGRSTHLLCESQVSNMYVQALREGKRCVTAHWLNTVLKRKKMVPPH
RTLHLPFAFPPGAKPCSQHIMSVTGFVDADRDDLKLMAYLTGARYTGYLCRSNTVLICKE
PVGLKYEKAKEWKIPCVNAQWLCDVLLGNFEALRQIQHSRYSIYTHSEPLMPNPQLVQNL
MAAWKMPVKITPEAMS
Download sequence
Identical sequences H3C8W0
99883.ENSTNIP00000004682 ENSTNIP00000004682 ENSTNIP00000004682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]