SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000004888 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000004888
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily E set domains 7.93e-49
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000828
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000004888
Sequence length 168
Comment (Tetraodon nigroviridis)
Sequence
GKLCLMVRVANMRKSLLIQCQLTGKLLHPSVTQEGEKTLVHQSPVDFYMDSSGDCPFLIL
PLTFYHVLDEHSPLAGLNARNLRRHDFELLVTLNATMESTAATCQSRTSYIPQEILFGYE
FRPVLFSTTGGRYVADFNFFDKVQLSSDSGFHSNDKEKLQLEEDYKKE
Download sequence
Identical sequences Q4TDK9
99883.ENSTNIP00000004888 ENSTNIP00000004888 ENSTNIP00000004888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]