SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000005078 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000005078
Domain Number 1 Region: 961-1013
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000614
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 2 Region: 332-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000226
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 3 Region: 1023-1072
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000145
Family Laminin-type module 0.042
Further Details:      
 
Domain Number 4 Region: 455-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000698
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 5 Region: 868-909
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 6 Region: 268-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000161
Family Laminin-type module 0.061
Further Details:      
 
Domain Number 7 Region: 1070-1120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000198
Family Laminin-type module 0.0024
Further Details:      
 
Domain Number 8 Region: 1179-1229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 9 Region: 411-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 10 Region: 1227-1274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000614
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 11 Region: 506-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000865
Family Laminin-type module 0.025
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000005078
Domain Number - Region: 919-963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000446
Family Laminin-type module 0.038
Further Details:      
 
Domain Number - Region: 1137-1176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family Laminin-type module 0.024
Further Details:      
 
Domain Number - Region: 1562-1617
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0377
Family HD domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000005078
Sequence length 1834
Comment (Tetraodon nigroviridis)
Sequence
FLLSLPPPAAVALGQELPSAPHGCAEGGCYPATGNLLIGRAANLSATSTCGLRGPEQYCI
VSHLQESDKCFECNSQVPGEPGRGRSSHRIENVIYLTDSSGEETWWQSVNGQENVSIRLN
LEAEFHFTHLIMKFKTFRPAAMIIERSADFGHSWRPYRYFASNCSRTFPGISAKALQRID
DIICEERYSDIEPSTNGEDSKVIYKVLDPHIHVKDPYSLDIQELLRITNLRINFTKLNTL
GDDLLDRRSDVLQKYYYAIFELVVRGSCFCYGHASECAPIPGVDARQAGMIHGRCLCKHN
TEGLNCERCKGFHHQLPWRPAEAENPHTCRECDCNGHSDKCHFDMAVYLATANTSGGVCD
DCSHHTTGRNCELCKPFYYQDPSRDIRDQHVCVACDCDPAGSLEEGLCDSHTDVRSGMIA
GQCRCKAHVRGARCDGCMEGFYGLSSSNPLGCESCNCDPRGTLGETPCDQISGDCACKRY
VTGRYCNQCLPEFWGLSNDRLGCRPCDCDFGGAYNNRIGRCLMENGQCDCRKHLIGRQCS
AVQPGFFCAPLDHYRYEAEDAAGRSPGDPLLPVSTLAWSQRVSMHPRSFRSDSPIHPPRV
VQGREPPSGLPQGKERPQAETDCVQHLSNQLRRHRRHRHVASVWQQRAALRRIRQLQQTV
RHTLCTQPDVSSLHRDRSLDRMVSWTGPGFARVKDGAGLVFTVEDVPYAMDYDILIRYEP
ESTEDWEAVVSVTSELLPSSLRCGNLLPTEQLYTAALPHRKRFVQMTRPFCFEPSNRYVL
VIRFQRQGVSHRHLTAFILVDSLVLIPKYTELAGFHGNKPEAERRRKEMEDYMCLDSFLM
TPTPALAEVCSTLICSISSILHDGALPCQCDPQGSLSSECSPVGGQCPCKAHVVGQHCDR
CAPGTYGFGVNGCAGECLGSGGTPLHPPGWAGQCRCRHGAVGRRCSDCQAGQWGFPSCSP
CQCNGHADLCHPHTGECRDCRDNTAGRQCERCVDGFFGNPVLGSGEHCRPCPCPGSPSSG
HFNAHSCQAEPTSDQITCNCKPGYTGPRCNQCAPGYYGNPEEAGGQCQPCQCNGNIDPDL
DPESCDPRTGQCLKCLHHTEGPSCAQCQLGYYGNALAQDCRRCVCVTSGTKPSACSEGRC
HCDRQSGACPCREHVEGHICDHCAPHHWNYGQAGGCQPCACDPDHAMGAHCNMFSGQCHC
QPGFGGRQCTECEQFHWGDPREQCQECNCHLLGSEVAQCDQDTGKCKCKVGMAGKRCDQC
ARGFVGPFPTCAPCHPCFQLWDDTICQLERDLENIQLMVKKVVESSGTPGFGHMKIRKLE
MKLMQVKNLLSQVESQQIHHLIGQSIEDLRAEIAVTDGHLTAVSRELNTSAETDAALRDT
LALMERQLTDINATTDALMKVKKYHRESEKAEEKCNATVTLIKDLLEASQDKLFQDLAAH
NRSIEELQGKAQELDRTVHLLTQKVCGAPDSTSGVCTGSQCGGEGCNGTVSVSVAAMNNA
NNVRDHLTAADEDLQGVNRQLKNIASLTLDVKNQVKHTLEKAQKNKQHFETGNRKLKDFI
QKIRDFLMEEGADPASIERVAQHVLSITLPVPRSTLEKMILQIKDSLANITDVGGIVNHS
SQHITKAKELLSQAKDANLYSTVIVNEISKNRFVKAIEKDKIIQRTKAQAEELKDVMTER
LTELEDKQMDIMIRLNNLSMATGSLRNKTEKNREMAKEAKSQADNATMLASSLEQVLNDT
EERYKTLQEKVGSLTGESGNIININKKAMEMKSEAEELLDKARKKIDQLRRLERKFRSNE
QQLQKQRVELDELKENVTLVRDEIRKQVQKYSSC
Download sequence
Identical sequences H3CA06
ENSTNIP00000000459 99883.ENSTNIP00000005078 ENSTNIP00000005078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]