SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000005249 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000005249
Domain Number 1 Region: 43-256
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.45e-76
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000119
Further Details:      
 
Domain Number 2 Region: 547-758
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-56
Family Ankyrin repeat 0.0000188
Further Details:      
 
Domain Number 3 Region: 252-383
Classification Level Classification E-value
Superfamily E set domains 5.37e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000326
Further Details:      
 
Domain Number 4 Region: 817-895
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000165
Family DEATH domain, DD 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000005249
Sequence length 943
Comment (Tetraodon nigroviridis)
Sequence
MAADEHYLHASNQIFDLPMLDAPWDFTPFPAMAQAPSLRTVDGPFLQIVEQPKQRGFRFR
YGCEGPSHGGLPGASSEKNRNTYPTINVNNYQGPARVVVQLVTALHQSPQLHAHSLVGKQ
CEKGICTADLQPKLPVLCSFPNLGILHVTKKNVTKTLEERMVEAFRMGHNYGVCIHPEID
GQQGEVRVPRELTDHQRSLISSAAAVQAKDMDLSVVRLMFTVFLPDSDGGFSRRLEPVVS
DPIYDSKAPNASNLKIVRMDRTAGCVSGGEEVYLLCDKVQKDDIQVRFYEEDDSGLTWEA
LGDFSPTDVHRQFAIVFKTPKYRDQNLQKPTSVFVQLKRKSDNETSEPKPFTYHPQVIGS
DKEEVQRKRQKTLPNFHDFLHRGGGPGAGGPGSAGGGGGSGCPGSDAHHLSFSPPGFFQG
FTTYKNTVRRTSGRQRGKPQVPFLVRKHPDQLITFNLMVGGVQASQGGAVSSDEDGDPED
GSGSAPRRKARPGIGSHWLDPRPPETAGAVLEVTSGQVEALFRYSVTGEAAHLLATQRSL
MDAQDEDGDSVLHLAVLHHQQEVLKSLVQVLSLLPGQDVLNARNHLYQTPLHLAVLTQQR
EAVQALLLAGADPTLADRHGNTPLHLASQQGGDGGMVGFLLQDEGMRGLLELPNRAGLCP
IHLAVLANQLSSLRELLEGGANVESQERSCGRSALHLATERDNVSLAGCLLLEGNANVDS
CTFDGSTPLHVAAGRGSAKLTALLVAAGADPRKENFEPLFFLQTSWLQSDKEEGYVPGTT
PMNIAATKQQVVELLNGKEYEPKPSLREPKPPPESDLVSLGLQVKQQVCQALEREALWER
LAQALGLGILNTAFRLSPVPARTLLDSYEVSGGTVSELLAALRSLGECQARSILEGALFP
SVDQGAGAANRRTGLCPPLPAGEQLKVELGLDGEACDSGVELS
Download sequence
Identical sequences H3CAH7
99883.ENSTNIP00000005249 ENSTNIP00000005249 ENSTNIP00000005249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]