SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000005259 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000005259
Domain Number 1 Region: 84-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000176
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 2 Region: 186-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000155
Family Laminin-type module 0.0068
Further Details:      
 
Domain Number 3 Region: 37-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 4 Region: 150-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family Laminin-type module 0.041
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000005259
Domain Number - Region: 1-30
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family Laminin-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000005259
Sequence length 238
Comment (Tetraodon nigroviridis)
Sequence
CEQGTGQCSCLAGYTGLQCEDCEDGFFTNGTSGCLVCACDSFGAVHLLCDSSGTCECKSG
VYGPKCDECHPGFFRFSSTGCRPCQCHNHTSYCHPQSGVCLNCEGNTQGSNCEECKPGFY
RSPERQPTEPCLACPCSNSTSSGLCRVGLWTRQIIECDLCLPNYAGLHCDECSAGFYKSS
KDCVPCECNGNADPEGPAQICRPDSGHCLQCTNNATGSRCHLCAPGFIGDAKAQNCTR
Download sequence
Identical sequences H3CAI7
ENSTNIP00000005259 ENSTNIP00000005259 99883.ENSTNIP00000005259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]