SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000005275 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000005275
Domain Number 1 Region: 19-123
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000187
Family Ankyrin repeat 0.0036
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000005275
Domain Number - Region: 457-514
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00013
Family Motor proteins 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000005275
Sequence length 572
Comment (Tetraodon nigroviridis)
Sequence
MMRGGAWGGGGEGLQHAVRHRGMTLLHLAAAQGYTHLIHTLIHWKVTMNNDSLDLEQEVD
PLNIDHFSCTPLMWACALGHQGAAELLYRWNSSALGIPDSLGRLPLAVARSRGHTRLATA
LEDLHTRALSPAEPSTLQPPSPSSSSLDTGLSSSSSLPSPSDPSSPSPSSAYSSGPALMD
MALSPPVPSSLHLSSLPAVSMLGEELDATLRTGTGLNADSSRDSFLFFMDYKSSCSPSPP
HSYPHGRVAGGGRGHMSEALEEQLLSYGENAENEGEEVEYLEEEELQVDMATLAEQIIQA
TPERIKQEDFPRGAESLLRERRDNVAVQDTWLATYLETVSPALSRSRCHSAHRSTTAGVC
TCRRMRPPSPLSALALQRLRPPSSAAWAEFLNASANGKMERDFALLTLTDGEQRELYEAA
RIIQNAFRRYRGRKLKEQQDVAAAVIQRCYRKYKRLTWIALKYALYKKMTQAAILIQSKF
RSYYEQKRFQQSRRAAVLIQQYYRSYKEYERLKQASRGAANHNPKIRGTFLTKKQDQAAR
KIMRFLRRCRHRIKELKQSRELERVAQHRLFP
Download sequence
Identical sequences H3CAK3
ENSTNIP00000005275 99883.ENSTNIP00000005275 ENSTNIP00000001683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]