SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000005333 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000005333
Domain Number 1 Region: 12-191
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.35e-30
Family Ankyrin repeat 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000005333
Sequence length 193
Comment (Tetraodon nigroviridis)
Sequence
MGLVYSQPACRSAYAGDVQGLFAVLSEDPSQLNAPDGHSGDTPLIAACRRGNLRAVQYLL
DNGADVRASNKKRRTALHYVSRRTFSLLDYLMIAVLMPVLLLGYFILGSSQKQRQTVALM
QVVLSSDVDVNAIDYKGNTALHYVCQRKSQRLVPLLLQEEASVHVRNEDGETPLDIATRL
KFNNIVNMLKKAA
Download sequence
Identical sequences H3CAR1
ENSTNIP00000005333 ENSTNIP00000005333 99883.ENSTNIP00000005333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]