SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000005358 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000005358
Domain Number 1 Region: 187-386
Classification Level Classification E-value
Superfamily E set domains 6.53e-55
Family Arrestin/Vps26-like 0.000000965
Further Details:      
 
Domain Number 2 Region: 9-181
Classification Level Classification E-value
Superfamily E set domains 7e-53
Family Arrestin/Vps26-like 0.00000808
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000005358
Sequence length 398
Comment (Tetraodon nigroviridis)
Sequence
VQTNMASKNVVFKKISKDKSVGVYLGKRDFVDRVDCVDPVDGVIIIDPEALQGRKVFVTL
SCTFRYRDDMDVMGVAFRRELYLSTTTGVPQPLQNSRSTPRARRRLLRKLGEEEFPYFNR
GFRTLTCASGEWLWQPAPHDVGNDRCAVEFEIKAFSAESQDAKVRKRSTVKLMIRKVQFA
PDTDAAAPSVETTRDFVMSDKPLHVKASLDKEVYYHGEPVKVHVSVTNSSSKNIKNIIVS
VDQVANVVLYSNDSYIKCVAIEETGDTVSPGASLQKTYSLLPLLANNRERRGIALDGKLK
HEDTNLASSSMTKAGVLKEVMGIMVSYRVTVKLVVAGMMGSSEVGLEVPFKLMHPKPDSV
RESEVEEEVEFQEFKRAYLKGMMDDEDEEGNLSGGDEM
Download sequence
Identical sequences H3CAT6
99883.ENSTNIP00000005358 ENSTNIP00000005358 ENSTNIP00000005358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]