SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000005481 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000005481
Domain Number 1 Region: 84-162
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 9.16e-23
Family Thyroglobulin type-1 domain 0.00014
Further Details:      
 
Domain Number 2 Region: 1-40
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000863
Family Growth factor receptor domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000005481
Sequence length 166
Comment (Tetraodon nigroviridis)
Sequence
QGEPCGVYTLSCASGLRCVPPPRDHSPLQALLQGRGFCAKYTRMVPTERPHPPGPHPSHS
SDIERQRHLHTCPEVMRSGAVLISSQAPCRKLLNSVLRGLELTIIQSDRDIYIPNCDTRG
FYRKKQCRSSKGMQRGHCWCVDELGSPVPSRARDDGTLPCDARSSP
Download sequence
Identical sequences H3CB59
99883.ENSTNIP00000005481 ENSTNIP00000005481 ENSTNIP00000005481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]