SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000005486 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000005486
Domain Number 1 Region: 6-66
Classification Level Classification E-value
Superfamily Cap-Gly domain 3.27e-25
Family Cap-Gly domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000005486
Sequence length 73
Comment (Tetraodon nigroviridis)
Sequence
LMLEAVPAAAVGRRVSCDGERATVRYVGPVPPTAGVWLGLEWDDPRRGKHDGSHDGVQYF
RCRYGGAGTGSEP
Download sequence
Identical sequences H3CB64
ENSTNIP00000005486 ENSTNIP00000005486 99883.ENSTNIP00000005486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]