SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000005497 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000005497
Domain Number 1 Region: 366-542
Classification Level Classification E-value
Superfamily p53-like transcription factors 9.32e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000442
Further Details:      
 
Domain Number 2 Region: 552-643
Classification Level Classification E-value
Superfamily E set domains 1.82e-24
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000005497
Sequence length 664
Comment (Tetraodon nigroviridis)
Sequence
QKSHYAHVTPMSPPRTLPLSLLRNRLPAQYNNLQSSTIRSVSVMEPHSYDNQDDMSATGY
YSPSNNRPNGAPTLESPRIEITSYGQFLEDEVEKSSLPVAKRVTSIVTLMLPNADGYRDP
SCLSPSSSISSRSCHSDASSYESGFSNYDNSPQNSPWQSPSVSPKSSTLVLPGDGCVSSG
SPRQSPSTSPGTRVTDDSCIGQRGSRPNSPFGAKRKYSFNSGNKHCTYSPNHSPGISPQT
SPRLSVTEETWLPNTNQYTNSAILAAINALTTDGMPELSEAIPMKSRKTSQDPDSSVSLK
MEPGAEDVNPAELCLDEHPTHHFPMKKEGYCSGFLDVPQPLYSWSKPKQLMTCFPPVSLA
LPALDWQLPSSSGPYSLQIEVQPKCHHRAHYETEGSRGAVKAAAGGHPVVQLHGYIESEP
LTLQLFIGTADDRLLRPHAFYQVHRITGKTVSTMSHEAMHNNTKVLEIPLLPDNNMRAMI
DCAGILKLRNSDIELRKGETDIGRKNTRVRMVFRVHIKQATGRTVSLQVASNPIECSQRS
AQELPLVDKQEEMCPASGGERMLVEGHNFQLDSKVVFVEKAQDGHHLWETEAKVVQEASK
STSLLVEIPPYRNQRLSTRVHVNFYVCNGKKKRSQHQHFTFVPANGKAIFKQLKNEGEVV
GGIK
Download sequence
Identical sequences H3CB75
ENSTNIP00000005497 99883.ENSTNIP00000005497 ENSTNIP00000005497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]