SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000005606 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000005606
Domain Number 1 Region: 105-162
Classification Level Classification E-value
Superfamily RING/U-box 1.29e-18
Family ZZ domain 0.018
Further Details:      
 
Domain Number 2 Region: 366-414
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000119
Family UBA domain 0.00029
Further Details:      
 
Domain Number 3 Region: 19-88
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000151
Family PB1 domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000005606
Sequence length 421
Comment (Tetraodon nigroviridis)
Sequence
RMSLTVKAYLLGKDEAVKEVRRFAVDHDVSSSFEYLCRKTAEIFSNLKNSAFTMFYKDED
EDLVAFSSDDELMMGLGCMKDATFRIFIKEKKEHRRDFLPPPMVPPQVLHPSVTCDGCEG
PVVGTRFKCSVCPNYDLCSACQAKGTHTEHPLLPIWHPLQGIHIGFLSAAVVSSGKVDEV
DETLYVEPEPGSQREPEPRPGPQPASCSNPSASQANVDFLKNIGEGVAAMLSPLGIDVDI
DVEHEGQRTKVTTPLQSEKAEKDLGAEAKDGGEVTSDCNTSEGTKVSSSETFPISICPLR
KEGGGGSCHCPPQAKQGHRDSDEEWTHLSPKEVDPSTGELQSLQNQGLPSGGPAGLKEAA
LYPHLPEEADPRLVESLAQMLSMGFTDEGGWLTRLLQAKNFDIGAALDAIQFARHPDQQP
R
Download sequence
Identical sequences H3CBI4
ENSTNIP00000005606 99883.ENSTNIP00000005606 ENSTNIP00000005606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]