SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000005690 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000005690
Domain Number 1 Region: 53-246
Classification Level Classification E-value
Superfamily vWA-like 1.53e-53
Family Integrin A (or I) domain 0.00029
Further Details:      
 
Domain Number 2 Region: 361-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000381
Family EGF-type module 0.008
Further Details:      
 
Domain Number 3 Region: 407-451
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.000000484
Family Chicken cartilage matrix protein 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000005690
Sequence length 455
Comment (Tetraodon nigroviridis)
Sequence
AGKMLWELLLFVLLADVRATYHLSPVDPQRVAAQSYAQTRNNARPPPRTLNPAKTDSSCL
SRPLDLVFIIDSSRSVRPSEFEKVKIFLADMVDTLDVGADATRVAVVNYASTVKTEFLLK
DHFNKPNLKKAISRIEPLATGTMTGLAIKTAVSEAFTEQSGARPRPRNIAKVAIIVTDGR
PQDQVEEVSAAARASGVEIYAVGVDRADMRSLQLMASVPLEDHVFYVETYGVIEKLTSKF
RETLCGRTKTERDTINPGSSSSVWGTYSLQGGEILSCERSLIWVTASDVWFDHFGSRTCC
RAAETNLELCKNRKGISCGKRTKFCCSGCGTSAFCSFTLSDTPKKFFFLNSSAPPYLTQG
VDPCAVGHDCEHICVNSNASYYCKCRNGYILNADKKTCSLKQVKVEVVEDPCKCEARLSF
QKQTQATIQQLTARLVSLADVSKRIERLEKSVGRV
Download sequence
Identical sequences H3CBR8
99883.ENSTNIP00000005690 ENSTNIP00000000387 ENSTNIP00000005690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]