SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000005820 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000005820
Domain Number 1 Region: 8-223
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.73e-46
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 226-271
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000445
Family SOCS box-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000005820
Sequence length 273
Comment (Tetraodon nigroviridis)
Sequence
QFYCTYQGPYSWADRSPLHEAASQGRLLALRTLLAQGYPANIVTIDQVTPLHECLSGHIA
CVRALLSSGANVNAATIDGLTPLYNCCRSGSASCMELLLQHGARAHSAHTHYPSALHEAC
KRGSSKCVKSLLSHGADPGYELSHLGSPLYISCLHRQAACSEILLRTGARVNAGRGSDSP
LHAAVRQDCVEQVALLLEFGADVNLRDDNNRKASELAPPGGHVQQLLKTVQDSPRSLCQL
CRITIRDVIGPLRLKLLPTLPLPPLLTGYLNHS
Download sequence
Identical sequences H3CC48
ENSTNIP00000005820 ENSTNIP00000005820 99883.ENSTNIP00000005820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]