SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000006045 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000006045
Domain Number 1 Region: 383-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.09e-31
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 
Domain Number 2 Region: 80-236,379-468
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.21e-21
Family HI0933 N-terminal domain-like 0.097
Further Details:      
 
Domain Number 3 Region: 768-800
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000506
Family LIM domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000006045
Sequence length 816
Comment (Tetraodon nigroviridis)
Sequence
MGDESLQRPGGAELFEAFVSSSTCRAALCSFGQLCERLQLALFRAIRSRLKSWKADALWA
KLERRAAHREYRQGGACRNTTCVVIGAGPCGLRTAVELSFMGARVVLLEKRDAFSRNNVL
HLWPFAIHDLRGLGAKKFYGKFCAGAIDHKSRQLQLVLLKVALLLGVEVHVHVEFQNLLE
PPEEQQNHAEVGWRLEVSPRSHPINQLKFDVVVGADGRRNTLPGEGFRRKEFRGKLAIAI
TANFRNRNTSAEAQVEEISGVAFIFNQRFFQDCGSTQGIDLENIVYYKDDTHYFVMTAKK
QNLLEKGVILQDFADTELLLSRDNVDQSALQAFARQAADFSTNQQLPSLDFAINHYGQPD
VAMFDFTCMYASQNAAMVRQRHGHRLLVTLVGDSLLEPFWPMGTGIARGFLAALDSAWMV
RRWSEGGAPLDVLAERRESLYRLLPQTTPENLQKNFALFTVDPTTRYANVNQLLVTPAQV
RHLVDTGEDAAVDTPPDDATSLPSPRFFSPGSPDGPEPSSCLLCLRWCQEQTGGYRGVAV
SDLTTSWRSGLALCALIHRHRPDLMDFDSLDQASGGQNARLGLDLAEQELGICPLVSVEE
MSSEGGPDWLSMVMYLSQFHQLFKDTPPPAGLLSRRPDLRSALLTPAVLLSRLGHGSSRE
GPGGRPGEAAEDQRGSFSRSEGRLLRHRPSSAAHVPLSCPPQSCDLAADALGQVCAAAPR
CSRVRRLANQLQAQLEESSAPCRSSAAAGALCPWKQRKRTLQQQHPQSSGASQVCCACQK
RLYVLERLSADGLFFHRSCFRCCRCRRWLQLGDFAF
Download sequence
Identical sequences H3CCS2
ENSTNIP00000006045 99883.ENSTNIP00000006045 ENSTNIP00000006045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]