SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000006343 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000006343
Domain Number 1 Region: 1214-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000126
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 2 Region: 1262-1310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000446
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 3 Region: 392-437
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000949
Family Laminin-type module 0.0096
Further Details:      
 
Domain Number 4 Region: 151-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000209
Family Laminin-type module 0.057
Further Details:      
 
Domain Number 5 Region: 1124-1172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000276
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number 6 Region: 210-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 7 Region: 347-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000893
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 8 Region: 280-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 9 Region: 489-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000642
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 10 Region: 542-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000019
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 11 Region: 454-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000006343
Domain Number - Region: 1175-1211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00781
Family Laminin-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000006343
Sequence length 1378
Comment (Tetraodon nigroviridis)
Sequence
QLFHVAYVLIKFANSPRPDLWVLERSVDFGQTYQPWQYFASSKTECVERFGQRTIERINT
DNDIICTTEYSRIVPLENGEIVVSLVNGRPGAMNFSYSPVLRDFTKATNIRLRFLRTNTL
LGHLMGKALRDPTVTRRYYYSIKDISIGGRCVCNGHAEACNAKDPNDPYKLQCDCQHNTC
GVSCDQCCPGYNQLPWKPATTYSANECEPCNCHRHSFDCYYDPEVDQRKTSLDVHGHYRG
GGVCINCQHHTMGVNCERCVPTYYRSPDYTIDSQLACSRCECDSQFTDGTCEDFTGLCFC
KVNFSGENCDQCASGFINFPHCYPMATYPTDNNNNGEAKPAGEIIMCGCSSVGSLPEVCD
TLGRCLCKPAFDGPRCEQCKSGFHSYPNCQACGCSAEGSHYSHCDRLSGQCVCRPGVVGR
RCDACTHGLYGFPSCQGFTTSSSGINSLSLSCSQDQCECRLHVEGPICDRCKPLYWNLSP
DSPDGCSDCECNTAGTLSRVAECAQDSGQCPCKPNACSGTCSTCKDGFYNLQQQNYFGCQ
GCQCDVGGSEGQACEERNGHCGCRPNVEGPKCNKPRKDHYFPNLHHLKYEIEEGTTPDGR
PVRFGYNSLEFPSFSWRGYAQMSSIQTAVKLQVHISEADIFLTRFILRYMNFEGSASNGK
ITAYQPLGTEQSKQIVFAPSVEPKFVNIPQNNFVEPFVLNPGTWTVLIEAEGILLDYLVL
LPSAYYEAPILQMRVTEPCSYTSEANSIHSCLLYRYLSLDSVPFISGNDASCVNDNHLPH
PCPTERVTPHHPDMAVCSGDDLTVELRGRLPSAGDYVLVMEYSSEEELPQTLSVTANVQG
ARRHHHLVTLLLCKYSFLCRAVAIDDHSRVAVFSLPADTEIRITSERATFFLHKVFLVPK
GQFSLEFIEPKVHCISNHGQFSPDSSSCIPSRFQMPSDSVVMKEESGWKGGDTPPHGADN
SDHVRLDSAQNAVVYSSRIHSLGRYVFIIHYHQPLHPAFPVQVYINGGRIWQGHFNASFC
PHAYGCRNILVSENQIILDVTDHDLLVTVQIPAGRMLWLDYVLVVPEGRYSSSFLNEEPL
DRSYDFISSCGQNSFSISSSSSSTFCLMSAVSLSAFFNNGALPCGCHEVGADSNTCQPFG
GQCSCRPNVIGRDCTMCATGYWGFPDCKPCNCGTRLCEPVSGDCICPPRTLQPECTQCEP
QTFGCHPVVGCEVCNCSYPGVVLPDVNCDRVSGQCRCKNNIVGRQCDRCAPGFYGYPNCR
PCNCNEAGTEEEVCDFVTGQCLCKENVQGSRCDQCKVGTFHLDPTNPKGCTSCFCFGATN
RCRSSDKRRTEIMNMEGWVLLGADRQEVPVTVYPGQDLVEADLSDIPDVYQDLYWHAP
Download sequence
Identical sequences H3CDM0
99883.ENSTNIP00000006343 ENSTNIP00000006343 ENSTNIP00000006343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]