SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000006346 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000006346
Domain Number 1 Region: 46-145
Classification Level Classification E-value
Superfamily E set domains 9.34e-17
Family Other IPT/TIG domains 0.0078
Further Details:      
 
Domain Number 2 Region: 248-336
Classification Level Classification E-value
Superfamily E set domains 0.00000000000644
Family E-set domains of sugar-utilizing enzymes 0.039
Further Details:      
 
Domain Number 3 Region: 143-193
Classification Level Classification E-value
Superfamily E set domains 0.000000028
Family E-set domains of sugar-utilizing enzymes 0.093
Further Details:      
 
Domain Number 4 Region: 1-32
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000733
Family Plexin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000006346
Sequence length 359
Comment (Tetraodon nigroviridis)
Sequence
SCGMCLKANPRFECGWCVQNKKCSLKQECISGNGGWMHASSENSRCSHPRITKLFPETGP
RQGGTRVTILGENLGLQFRDIQMGVRVGKIPCMPVEEEYVSAERIVCLLNDATNYRVQEA
HVEVCVKDCINDYRALSPRPFTFVTPYFNRIQPSQGPISGGTRITVEGSYLNAGSYVSVR
FAQRPCFFKRKVKHCLLSCASFVGMNEGYAPNTVSNYLIDSGQKHYTFRLQFLRHKVTTK
LSLTFCIYSGGTLLTVSGTNLATIQEPKIRAKYGQVESFHNCTVYNNSVMVCLAPSVADS
ELGFSESGTDPDEIGFYLDNVNALVVVNKTFSYYPDPVFEPLSPSGVLELKPTSPLILK
Download sequence
Identical sequences H3CDM3
ENSTNIP00000006346 99883.ENSTNIP00000006346 ENSTNIP00000006346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]