SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000006537 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000006537
Domain Number 1 Region: 10-60
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000262
Family Plexin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000006537
Sequence length 90
Comment (Tetraodon nigroviridis)
Sequence
QVTQVPIESCEQYGTCGECLSSGDPHCGWCVLHNICSQRSRCERADEPYRFAASITQCVK
VSVYPASIAVSEPSVPVSTLQRNAHSRPRL
Download sequence
Identical sequences H3CE63
ENSTNIP00000006537 99883.ENSTNIP00000006537 ENSTNIP00000006537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]