SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000006578 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000006578
Domain Number 1 Region: 595-691
Classification Level Classification E-value
Superfamily PDZ domain-like 1.46e-18
Family PDZ domain 0.000011
Further Details:      
 
Domain Number 2 Region: 1809-1879
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.14e-18
Family SAM (sterile alpha motif) domain 0.00023
Further Details:      
 
Domain Number 3 Region: 122-149,266-322
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000852
Family Ankyrin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000006578
Sequence length 1881
Comment (Tetraodon nigroviridis)
Sequence
AHINWLVVRVLIPDLQQTKCLRFDPAATVWSAKQRVLCSLSRSLKGALNYGLFQPPGPGG
QGRFLEEERLLREYPQPISRGVPALEFRYKSRVYKQPPLEEKQICKLHTKANLRRFLDLV
QQRQVEKVSQLLERGLDPNYQDSETGAIPLRLPPRSGVSVSDSRKLNSQQLVVELKTVFV
FTCVRGACVVEHFVGDLCSRLKPLSTLPEDQILRQALFLTRVLELGPLAPPAWHLLLLTP
ASGRSFWRERSSPPFRGGALRSFRTLPSACLSPFLLLLQETCARVLLARGADKEVKNFNG
QSPSQVAIIAGNFELAELIKKHKDSDIVPFREAPAYSKRRRGPSAGNGSEPSSSSLAAPR
VLLRSNSDNNLTVGQYQQHGWTGGAQQQQHAQARLQRPPQQGPPQPGSSALHRSLSPQLL
QQMPSGSPNGNVVVRTMGRGARSRSPSLSRLGEEVRRAQRQPRPSTSAAAQRSPTCGSGT
GTGPWVLRCRAAQEETVSVLPHRNNHTIKSSTKGASCKLSFGIKHHNSATEVGGGGVVPG
VVPGVCGDGFLLCLADSRADRADRRKLFRHYTVGSYDSFDASRSGGGGGGGGDCVVDEKT
VVLQKKENEGFGFVLRGAKADTPIEEFTPTPAFPALQYLESVDEGGVAWQAGLRTGDFLI
EVNQENVVKVGHRQVVNMIRQGGNRLLIKVVTVSRNLDPDDTARKKAPPPPKRAPTTALS
MRSKSMTSELEELDQFPWQPSPCVDVQKKRIVFQVTLNKVEEMTHAQKASPIDMKIATIK
PRPSSRCLVTAADMNSMYHDRQGVAVVPPTVPGAYLGIPEKGTMRKQKSIGTAEDEKQGF
LTPPLLKFARSLSMPDTSEDIPPPPAISPPSPPAYNSPAAPGPKGYGATRPSFTQNSANA
VTTISQTGNVGTLRGSEQFESTRTRGRTPVPENPYSEVGNKTLYIPAKPARRKGMLVKQS
NVEDSPEKTCHMPASPSGPVSMPTTPVERTCSSIPIPTIIVKEPSTSSSGKSSQGSSMEI
EPTTPEHPPLAPTVGGSGGLRPDDPLSLSNPFAAAIAGAVRDREKRLEAKKNSVAFQSID
MGDDDFCSPTPTPRLRQSKSIDEGMFSSDERLRRILAPPPAAQLGPPVGGGSGNMTDFNT
PEPTVHPVTGKPLDPNSPLALALAARDRAMKEQQNHPQNQPQNPPQVPQAPKHEAQSLPV
QPSHKPDLNQPLFIDTKRQMTEQKYETDGAREERQHRALEERKSAPADVTDASKPKSAGL
LMVHTSTDPNKTSNQDAEGQDSNRPAELKDPNQPDPLKASMLAANPLPPSARRRSIPLGD
SMDEPVKLPFRIPPPPLASVDIDEEFEFSEPLPPPLEFANSIDIPDDQASAIAEMLKQQR
RNGGPALPPYHPHAPPPVADHHKRVPNSKPPAYAPPPDHESAVGDSGIEEVDSRSSGDPQ
HMETTSTVSSISTLSSEGGFCDSTLESLYTSADGHAFLVERPPVPPKPKGKSIINRTSLY
HDALIEEAPESYGTPPQAPPPPPSSSEPPRTPTQRSSKLWGDPPSTPDSKNTVIGEFSPQ
LHVCVLSQFSPALPWQPAPSEKPVWRTGAPRPSGVEVGSGCAALLRPFSHSRRCHGAGLT
VVGAADGSSEDGLDSHTLARFVFPYFSSWIKRVGFCLRMKGLPGNQLIRAALRPVVMPVS
AGGGGRRYVTSTAPIRNRARPPAVSGSELSVCSVLTSDLRPPPGSSTPPGSLPSQTHPCS
PPDSASSLTPCSSLPPSVSPTLTDVFGLATPPMGSGGGYSLSSSCGGSGSSRSPSPLTLM
QAASASGKAFASKPVELWSKHDVADWLESLNLAEHRDAFLDNEIEGAHLPSLQKEDLIDL
GVTRVGHRMNIERALKLLQDR
Download sequence
Identical sequences H3CEA4
ENSTNIP00000006578 ENSTNIP00000006578 99883.ENSTNIP00000006578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]