SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000006703 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000006703
Domain Number 1 Region: 351-462
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-24
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 2 Region: 469-534
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000361
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 178-286
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000981
Family Spermadhesin, CUB domain 0.0051
Further Details:      
 
Domain Number 4 Region: 529-590
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000278
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 112-179
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000283
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 6 Region: 597-656
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000433
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 7 Region: 1-113
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000124
Family Spermadhesin, CUB domain 0.0072
Further Details:      
 
Domain Number 8 Region: 290-349
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000278
Family Complement control module/SCR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000006703
Sequence length 751
Comment (Tetraodon nigroviridis)
Sequence
CNATLSAADDVVESPDPASSSSFSPLECTYSITVYAGYGVEMQVKKINLSKKESLTIMSY
GDSGPELLANETLMREGQVIRSSSNQVYIHYRSLQQSNHGVFSLHYQAYLLSCPFPLSPE
NGGVTVTDIHPGGQAHFHCDPGFQVRGHEEATCVNATVPRWSTPEPQCVGRYHGSPPTAT
VGRILSPPPASVSNHSNGSNLSCHWLIEAKEGHRLHLHFERIAFDENDDKLIVRSSNSSL
SSSLFDSDLDDVPERGLLSEGSTLYLELTADSSSIPLLFALRYEAFDDEHCWEPYMPHGN
FSSSDISYQLGTTVTFSCSPGFVMEQGSATIECIDPSNPHWNDSEPVCKAQCGGELTKPS
CTILSPDWPQSYSKGLDCVWQIHGNEEKRIELDIQILNIRHTDVLTIFDGQDLMSNVIGQ
YVRSKERFQVVSGGSEVTIQFQSDPDDSSFISSQGFVIHYREVEPNDTCPTLPPIEFGWV
TSSHSSNVRGSVLTYQCQPGYDISGSDIVTCQWDLSWSSSPPTCVKVQQCPDPGEVVNGA
RSVRPETGFAVGTLVRFSCNQGYQLEGPSQISCHGRDTGTPKWSDRSPKCVLKYDPCPNP
GVPDNGYQTLYKHSYQAGETLRFFCYEGYELIGEVIISCVPGHPSQWNNPPPFCKVAYED
LLDDHKLEVSQSLEPSHQILSENIALAIILPIILVILLIGGIYMYYSKLEWKPLFWKSLS
HTHSYSPITVESDFNNPLYEAGDTREYEVSI
Download sequence
Identical sequences H3CEM9
ENSTNIP00000006703 99883.ENSTNIP00000006703 ENSTNIP00000006703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]