SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000006791 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000006791
Domain Number 1 Region: 315-452
Classification Level Classification E-value
Superfamily TIMP-like 4.87e-28
Family Netrin-like domain (NTR/C345C module) 0.019
Further Details:      
 
Domain Number 2 Region: 88-185
Classification Level Classification E-value
Superfamily Immunoglobulin 7.13e-24
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 258-323
Classification Level Classification E-value
Superfamily BPTI-like 4.11e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0032
Further Details:      
 
Domain Number 4 Region: 1-47
Classification Level Classification E-value
Superfamily Elafin-like 0.00000209
Family Elafin-like 0.0019
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000006791
Domain Number - Region: 205-263
Classification Level Classification E-value
Superfamily BPTI-like 0.00184
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000006791
Sequence length 459
Comment (Tetraodon nigroviridis)
Sequence
HAGICPNDMNPNLWVDAMSTCTRECESDQECESFEKCCPNVCGNRSCVAARHVDGKDAEA
CSKGITLSVVTCRSAPLQATVPPPAKPQPPLIHVSPTHQTVKAGETASFLCDVTGHPQPE
ITWEKHLPDGEERLVLTPNHVRGNMVVTNIGQLVIYNAQPRDSGLYTCTAQNPSGSVQAN
HPLTVVPAEPPQSSEHQNLSRCLTEECLRPPEPSEDCGGKVEKVSWFFEPKTNNCFSFAH
CGSNSTQSQRLLNTYAECMRCCGPELSEPCGLPALQGPCKSYEPRWAYSSSLHQCQSFIY
GGCEGNNNNFESKEACEETCPYRKNHHCRACRPRGKIVTSFCRSDFVILGRLTELTEEKD
SGHALVMIDEILKDEMMGLRFFGTEPLEITFLNMDWSCPCPNIKGGAAEGQVIIMGNVRD
GMAVLQPESFLGASSPRRVRKLREVISKNTCEILKTITN
Download sequence
Identical sequences H3CEW7
ENSTNIP00000006791 ENSTNIP00000006791 99883.ENSTNIP00000006791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]