SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000006994 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  99883.ENSTNIP00000006994
Domain Number - Region: 39-97
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000156
Family C-type lectin domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000006994
Sequence length 103
Comment (Tetraodon nigroviridis)
Sequence
VAPRGANSSWIPDATVVTPEEPIFLMTSTAQTISGFFVWTALLITCHQIYMHLRYYSSPN
EQRHIVRILFIVPIYAFDSWLSLLFFTNEEYYVYFDTVRDCYE
Download sequence
Identical sequences H3CFH0
ENSTNIP00000006994 99883.ENSTNIP00000006994 ENSTNIP00000006994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]