SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000007062 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000007062
Domain Number 1 Region: 1263-1525
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-53
Family YWTD domain 0.00000222
Further Details:      
 
Domain Number 2 Region: 1880-2109
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-43
Family YWTD domain 0.0000157
Further Details:      
 
Domain Number 3 Region: 1575-1830
Classification Level Classification E-value
Superfamily YWTD domain 1.28e-41
Family YWTD domain 0.0000479
Further Details:      
 
Domain Number 4 Region: 536-775
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-41
Family YWTD domain 0.00000991
Further Details:      
 
Domain Number 5 Region: 2220-2453
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-24
Family YWTD domain 0.0002
Further Details:      
 
Domain Number 6 Region: 2995-3240
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-17
Family YWTD domain 0.00053
Further Details:      
 
Domain Number 7 Region: 2908-2986,3233-3294
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.26e-16
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 8 Region: 1177-1257,1519-1567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000228
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 9 Region: 202-373,408-431
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000107
Family YWTD domain 0.0026
Further Details:      
 
Domain Number 10 Region: 883-926
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 11 Region: 925-966
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 12 Region: 3447-3483
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 13 Region: 847-885
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 14 Region: 3322-3366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 15 Region: 2656-2692
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 16 Region: 1834-1884
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000963
Family EGF-type module 0.012
Further Details:      
 
Domain Number 17 Region: 968-1006
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 1008-1044
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00031
Further Details:      
 
Domain Number 19 Region: 3405-3441
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 20 Region: 3364-3401
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 21 Region: 3564-3607
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 3917-4035
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000654
Family YWTD domain 0.0011
Further Details:      
 
Domain Number 23 Region: 1054-1091
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000668
Family LDL receptor-like module 0.0006
Further Details:      
 
Domain Number 24 Region: 3525-3560
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000707
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 25 Region: 25-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000772
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 26 Region: 3285-3319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000916
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 27 Region: 3606-3650
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000929
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 28 Region: 3482-3522
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000929
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 29 Region: 2813-2854
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 30 Region: 2777-2811
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 31 Region: 150-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000272
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 32 Region: 3690-3729
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 33 Region: 1102-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 34 Region: 70-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 35 Region: 1137-1172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000209
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 36 Region: 4253-4294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family EGF-type module 0.033
Further Details:      
 
Domain Number 37 Region: 2143-2192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000371
Family EGF-type module 0.024
Further Details:      
 
Domain Number 38 Region: 4154-4187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000978
Family EGF-type module 0.047
Further Details:      
 
Domain Number 39 Region: 4117-4155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000456
Family EGF-type module 0.02
Further Details:      
 
Domain Number 40 Region: 4081-4117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000671
Family EGF-type module 0.014
Further Details:      
 
Domain Number 41 Region: 119-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000887
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000007062
Domain Number - Region: 799-839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000117
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 486-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000701
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000007062
Sequence length 4434
Comment (Tetraodon nigroviridis)
Sequence
CQPSPHAAFSPLFSPLFPCAILDAILCDIGEFHCRDRKTCVPEAWLCDGEPDCPDDSDET
DTICTHQVVVRCPLNHIQCIGTKKCIHFNKLCNGARDCEDGFDEGVHCRELLSACHELRC
RYGCVMTRNGTFCFCGDGFEVGADGTSCKDHDECATYGACSQTCENTHGSYSCSCAEGYV
LQPDRTSCRARQDPGDSRPVLLVGGSDRVVITNLNGTGLQPLRSLSVNGSLTLDFQHNQG
SVCWVLSTKSSGQLYCAEMRNLRGFTREHEVRTQQSLQHVDNMAIDWLTGNRYFIDRITD
KIFACNQEGDTCVTVLHLDLQNPKGMALDPLMGKVFFADADSFPQPAWGSKGSPSLLRLD
SRRLSWLPVVLLLQLVISGSCWSSILTEPQQDSQRCDSGKHFIAQNIIVSYIYALSVFED
HLYATHSDPSTGSSSVELIRIHRFNITAEIKTLATLGTSKQLRVYHKLAQPKVRDHACDT
DSRGKPGGCSHICLLSGSYKSRTCRCRTGYSLGPDTQSCKKPKKDLFLFYGKGRPGVIRG
LDMNIKSSDEHMEPIVDLVNPRAIDYNAELGHIYFADTTSFLIGRQKLDGTGRETILKDE
LDNVEGISVDWIGNNLYWTNDGYRKTISIARLDRASQTRKTLLEGNMSHPRAIVVDPPNS
WMYWTDWEEDEVNDSIGRIEKAWMDGSNRRIFVTSNMLWPNGLTLDHSTSTMYWCDAYYD
HIERIYLNGTGRTVVYNGKELNHPFGISHYRNYIFWTEYMNASVFQLELSTGDVTLLRSE
RPPLFGLRVYDAQSQQGDNACSVNYGGCSTLCLAIPGGRVCACADNQVLEKNKVTCAEAS
GGGSELQPCRKDEFQCRNQRCIRALWKCDGDNDCLDGSDEETLSCYNHTCPAGYFKCNNN
RCIPKRWLCDGTNDCGSNEDETNSTCSAQHCQVDQFPCMNGRCIPQAWSCDRENDCGDMS
DEISCTFPTCEPLTQFSCSNGRCISAQWHCDSDDDCGDGSDEVGCARSCANSQFQCTSGR
CIPDHWACDGDNDCGDYSDENTCKGGAALLPSVIECGAEEFHCVTDGTCIPERWRCDGDK
DCEDGGDEKDCEGTRRMCDPKAKFTCKDTGKCITKSWVCDGDIDCEDRSDEESCETAVCK
PPKYPCANDTSVCLTPDKICNGKVDCADRSDEGPICDLCLVARGGCSHQCTVAPGKGVVC
FCPPGLHLDSSNKTCEVVDYCSRHLKCSQVCEQYKTTVKCSCYPGWAMDPDGDSCHSTDP
FEAFIIFSIRHEIRRIDLHKRDYSLLVPGLRNTIALDFHFNRSLLYWTDVVEDKIYRGRL
SESGGVTGIEVVVQHGLATPEGLAVDWITGKLYWIDSNLDQIEVAKLNGDMRTTLIAGGM
EHPRAIALDPGQGILFWTDWDATFPRIEAASMSGVWPAQTWRRERWPNGLTLDHQEKRIV
WTDARSDAIFSALYDGSGVIEILRGHEYLSHPFAVSLYGGNVYWTDWRTNTLARANKWTG
QNVTVIQKTSAQPFDLQIFHPSRQPQASNPCEKNDGRGPCSHLCLINYNRTASCTCPHLM
KLSPNKQSCFAVKRFLLYVRRSEIRGVDIDDPYMNIMTALTVPDIDDVTVVDYDATEERI
YWADIKTQTIKRAFINGTQLETIISADIVNCRSLALDWLSRNLYWLSSENDESQINVARF
DGSLKTSIIHGIDKPRCLVVHPARGKIYWTDGNTINMANMDGSNSKVLHQNQRDPAGLSI
DYAASKLYWISSANGTINRCNLDGSSLEVLETLKRDLVKGTALAVMGGKLWWADDDSGQL
GTVTKRDGKNLAILRNKTSGVIHMKVYDREAQKGRNPCQVNNGGCSQLCLPTSENTRSCS
CTVGYNLRSDRVSCEGVDSFLIYSIHEGIRGVALDPNDNSEALMPITGTLFAVGVDFHAG
NDTVYWTDMGLNRISRAKRDQTWREDVITTGISRVEGIAVDWIAGNLYWTDHGFNLIEIS
RLNGAYRSVVISEGLDQPRAIAVHPQKGFLFWTEWGKIPCIGRSRLDGSDQVTLVNSGVM
WPNGISIDYEENTLYWCDARTDRIEKINLETGENREIVLSAANVDLFSVAVFGPYIYWSD
RAHSNGSIRRGFKTDTSEPLTMRSGLGVNLKDVTVFSRGREKGTNPCARSNGGCQQLCFH
LGSGRRTCSCAHGRLAQNGFACERYEGYLLYSRTILKSIHLSDESDLNSPVQPFENPAFF
KSIIALAFDYSQTTAGINRIFYSDGHFGNIQMINDDWTGRSVVAENVGSVEGLAYHRAWD
TLYWTSSTTGTISRHTLDQSRVGAFVREAVVTLSEDDHPHMVALDECQNLMFWTNWNEQR
PSIMISTLSGKNMRIIIGSDVTPNGLTVDHKAVKLFFSDGSLVKIDFCHSPDGQSLVIVK
SGPGNFYGLAIHSDFIYWSDWARRVLRSNKYTGSDTKVLRADIPHQPMGIIAVARDTNNC
KYLSNRKPMDAMLSASICLLDLVQGSPKTACFVCFSDVSESCNVTPVPAEPASLFVVLPT
QLCNIGSITQNFFCSNIRQRISGTELSCISALLWTSPCCVISAFTAIISTTILTSCSSSY
NKSLTTSSQELLWSNNLSVQSCPKKNNKFGFRNTKNFLPNCAMNLERVPALFILCSAGSQ
WSDMVLLLFFQVSHGQKCEEGHFACPSGNCISSVWLCDGQKDCEDGADEFQCGKPTPPSS
VCSTQGSLPTQLCSKIGKDCCLKAAQDLNRSHSVLKKCHLCLRETIKFHVSKRSWYKSCH
NSEEXSDELAAAGCAPNNTCDDNSFRCNNKVCVPQRFVCDRDDDCGDGSDESVECVYRSC
GSEEFRCRDGRCLLSSQWECDGYADCPDHSDELPLNLKCLAAGKTTVWLSAGISSLVSAA
ALLSQELICQVPLSCHHMWGRAGQRVHQCRPLSSSICSLNRKISRKVLKCKCWPGFYLKD
DGKTCVDIDECATTLPCSQRCINTYGSYKCLCVDGYEALERNSNVCKALSAEEPFLIMAD
HHEIRKLSVDGSNYTILKQNLSSNTPYLFIFSTSHVMLLNFSADYDSIAIYIYNKISNSA
MSHKTVINNLANYQDIFPKDKNRVKIEAFKAVSLTSCHTFEPLRDLINPSTSYVFWVDCC
EPPHIGRIGMDGQGQVVIINKEIYNPTALTIDYTNKRIYWADDNHILLSSMDGTQRRKVA
YEHIQGVMALTLFEDFVYWTDGKSKSLRRAHKTTGAQGMELLNSWQAIKSIKVYHSLRQP
EVPKHQCQIANGGCSHLCLLSPGGGHKCACPTNFYLAADNKTCLSNCTSSQFRCGTDECI
PFWWKCDTVDDCGDGSDEPADCPEFKCQPGRFQCGTGLCALPPFICDGENDCGDNSDEAN
CETYICLSGQFKCTRKQKCIPLNLRCNGQNDCGDGEDETDCPESTCSPDQFQCKASMHCI
SKLWVCDEDPDCADGSDEANCDEKDEKTCGPHEFRCENNNCIPDHWRCDSQNDCGDNSDE
ENCKPVTCNHKEFACADGDCISSRFRCDGDYDCLDNSDERGCEERCADDQFQCHNNLCIS
LKWLCDGQEDCKMGEDERNCQGTECREDEFLCLNRAHCIPRRWRCDEVFDCMDHSDEENC
SQGAFFCRADEFICNNTLCKLQMWVCDGKDDCGDNSDEDASMCAKHACPPTRPSADYRNQ
NCTFISIYFIGISNLNRDNLCTQAETVTRRSRPCGKTEFTCSNQRCIPMQLQCDLFNDCG
DAGSDEQDCKARKCGLRSALCGRHWRLPGFCTSKEKHSRSPGCKRTQALVCFHSVQRRYM
WKENQSMRRGRRLQPDKRQQHLPVQSWLPEEPEERPVQKVTPPGLAGPPHSFISSHASRL
SFCKRFDRGLKTITHGCFNKQSLFVAINLAQVDTAFGVVLIGKMELELRKQMINFSLNMP
HFNNIFIDQMFGKWSFFSPQSWTRVLITAPTPKDLLNVPATXAIDYFNHRLYWADPELSH
IGSMRTDGSDPLVTISERHGVSQPYRIDIFEDYIYGTGLKHEIFKIHKYGKQPVEFLNLG
MVKPTNVLIYHRYKQQDASNPCLRMSCDFMCLLNPTGARCTCPEGKVLLNGTCADAVVSG
ELCRPPCENGGRCLANEKGDWRCYCWPDFSGERCEVNHCTDYCLNGGTCTGSPLGKPTCR
CPLGFSGPFCERRICENYCLNGGTCEVTEGNQPVCRCLAEYTGERCIYHICHHYCVTSKA
CTLSSSGYVECVCPARFEGNKCEVDKCLRCHGAPCLINEDTGDVVCNCTNGRIAPSCQLC
DGYCYNGGTCHLDPDTNLPFCQCSANWAGTQCERPAPRSSRSDSTSGGSIAIIVPLVLLV
ILIVVVVTGVYVCRRRQRGKRVQRQPMTNGGINVEIGNPSYNMYEVEHDNHADAGSLLRP
NFTLDPHKPVNYSNPVYAKIYIDGQNCRKPVISIDERRELLPKKLEGTIHETAA
Download sequence
Identical sequences H3CFN5
ENSTNIP00000007062 99883.ENSTNIP00000007062 ENSTNIP00000007062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]