SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000007070 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000007070
Domain Number 1 Region: 14-152
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.02e-29
Family Laminin G-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000007070
Sequence length 163
Comment (Tetraodon nigroviridis)
Sequence
PLWPLAFFGLLATVRMLEFGGAPGQWARYGRWEAGSEGELSFSVRTNASKALVLYLDDGG
NCDFLELLIAAGRLQLRFAIHCAEPATLHMETRVNDDRWHMVLLTRNFRETLLMVDGETK
VAEVKSKRKEMAVVSDLFVGGIPPDVRLSALTSSTVKYEPPFQ
Download sequence
Identical sequences H3CFP3
ENSTNIP00000007070 99883.ENSTNIP00000007070 ENSTNIP00000007070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]