SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000007107 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000007107
Domain Number 1 Region: 217-393
Classification Level Classification E-value
Superfamily MIR domain 1.29e-46
Family MIR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 1079-1193
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000148
Family SPRY domain 0.049
Further Details:      
 
Domain Number 3 Region: 659-798
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000135
Family SPRY domain 0.06
Further Details:      
 
Domain Number 4 Region: 3990-4068
Classification Level Classification E-value
Superfamily EF-hand 0.00000193
Family Polcalcin 0.079
Further Details:      
 
Domain Number 5 Region: 420-536
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000549
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 
Domain Number 6 Region: 1416-1536
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000095
Family SPRY domain 0.04
Further Details:      
 
Domain Number 7 Region: 101-183
Classification Level Classification E-value
Superfamily MIR domain 0.0000445
Family MIR domain 0.028
Further Details:      
 
Domain Number 8 Region: 2145-2215
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000536
Family IP3 receptor type 1 binding core, domain 2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000007107
Sequence length 4935
Comment (Tetraodon nigroviridis)
Sequence
MAEGGEGEEEIQFLRTDDQVVLQCTASVLKEQIKLCLSCEGFGNRLCFLETTSNAQNVPP
DLAICTFILEQSLSVRALQEMLANTVEMTESSQGGGHRTLLYGHAILLRHNHSAMYLSCL
TTSRSLTDKLAFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLH
LSYASGDLMVDASFMQTLWNMNPISSGCELAEGFLTGGHVLRLFHGHMDECLAIATPEEG
EEKRRMAHYEGGSVCSQARSLWRLEPLRISWSGSHMKWGQSFRIRHITTGRYLCLDEEKG
LLVVDPERADTKHSAFCFRASKEKVDVAQKRDVEGMGIPEIKYGESMCFVQHVSTGLWLT
YAALDAKAARLGMMKRKVILHQEGHMDDALTVSRSQTEESQAARMIYSTVGLFRQFIKGL
DTLTGKNKSPGAVALPLEGVILSLQDLIFYFRPPDEELEHEEKQTKLRSLRNRQNLFQEE
GMITIVLECIDRLNVYNTAAHFSEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFT
NLDWLVSKLDRLEASLSILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDV
LRSLCVCNGVAVRSNQNLITENLLPGRDLLLQTNIVNYVTSVRPNIFLGTCEGSTQYKKW
YYEVMVDHVESFVTQQATHLRVGWAMTDGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHLW
SGTVPRQVASPSAHTLAADDVVSCCLDLSVPSISFRINGHPVQGMFENFNVDSLFFPVIS
FSAGVKARFLLGGRHGDFKFMPPPGYAPCYEALLPRERMRIEPIKEYKHDFSGVRNLLGP
TLSLTHTSFTPCPVDTVQIVLPPHLERIREKLAENIHELWAITRIEQGWTYGVFRDDNKK
LHPCLVDFQSLPEPERNYNLQMSGETLKTLLALGCHVGMGDEKAEENLKKIKLPKTYVMS
NGYKPAPLDLSHVRLTPNQNQLVEKLAENGHNVWARDRVRQGWTYSIVQDILNKRNPRLV
PYVLLDEKTKKTNRDSVNNAVRTLIGYGYNIEPPDQESTGHGLENTRGDKVRIFRAEKSY
AITQGKWYFEFEAVTTGEMRVGWARPNVRSDTELGADELAYVFNGNKAQRWHIGNEPFGR
QWQSGDVVGCMIDLTEMNIMFTLNGEMLISDSGSEMAFKDIEIGEGFIPVCTLGLSQVGR
INLGQNVSSLRYFAICGLQEGFEPFAINMKRDTTMWFSKSLPQFVPVPTDHNHIEVSRVD
GTVDSAPCLKLTHKTYGSQNANTDMLFLRLSMPIQFHTTFKIPAGTTPLTRALNIPEDIA
VVEPDSEFEVLKKSASRKEQEEDKKEPSVPKEVLAENEKDTVSEKGKKRGFFSKAKKAAM
TPLAPPPAPPTVPRLVEDVVPDDRDDPEIILSTTTYYYSVRIFAGQEPSGVWVGWVTPDY
HQYDQTFDLSKVRSVTVTVGDDKGNIYNSMKHSNCYMVWGGDLVSNHQTRFSQEDMVIGC
LVDLATGLMTFTANGKEINTFYQVEPNTKLFPAVFIQPLSQNLVQLELGKLKNIMPISAA
MFRSERNNPVPQCPPRLDVQMLTPVIWSRMPNRFLNPEVGRVSERLGWVVECTEPLIMMA
LHIPEENRCIDILELSERQDLMKFHYHTLMLYCAVCALGNNRVAHALCSHVDESQLFYAT
ENTYLPGPLRSGYYDLLISIHLESAKRARLGTNREFIVPMTEETLSIKLYPDAVKAHSLP
GVGLTTCLRPKLHFSSINFVGTDPDLYTLSPVFPLQELKTRAISMLTEAVLDGSQAMRDP
VGGSVEFHFVPILKLINTLLIMGIFNDEDTKHILKMIDPNVFSGKDEEEDTEKPTEGGTA
EDDKAKEEESEEAAELLQMKLPESVKLQMCTLLQFFCDCELRHRVEAIVAYSDKFVHDIQ
DNQRIRYNQLMRAFTMSAAETARKTREFRSPPQDQVLLLTNFKHSLEDEECPVPDDVRDT
LKEFHNDLLLHCGIHIEEEAVEEEVDTSLRGRLLSLVDKIKSLRGKKTEEKPEVEEETKP
STLQELISHTMIHWAQESFIQNPELVRLMFSLLHRQYDGLGELIRALPKAYAINAVSVQD
TMDLLECLGQIRSLLIVQMGPEEERLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVM
VNVLGGGDSKEIRFPQMVTNCCRFLCYFCRISRQNQRSMFDHLSYLLQNSSIGLGMRGST
PLDVAAASCIDNNELALALQEQDLEMVVMYLASCGLQMCPMLLSKGYPDIGWNPCGGERY
LDFLRFAVFVNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAMEEAIKISEDPA
RDGPTVKKDRRFMFGGEEQQEENRVHLGNAIMSFYSALIDLLGRCAPEMHLIQAGKGEAL
RIRAILRSLVPIEDLVGVISLPVQIPSYGKDGQIIEPKMSASFVPDHKASMVLFLDRVYG
IDNQDFLLHVLEVGFLPDMRASASLDTVAFSTTEMALALNRYLCSAVLPLLTKCAPLFAG
TDHRAIMIDSMLHTIYRLSRGRALTKAQRDVIEECLMSLCKYLRPSMLQHLLRRLVFDVP
ILNEYAKMPLKLLTNHYERCWKYYCLPNGWANFGVTSEEELHLSRKLFWGIFESLAHKKF
DAELFKIAMPCLCAIAGAIPPDYVDASYSSHTEKKASVDAEGNFDPKPVETTNTIIPERL
DTFINKYAEHTHDKWAFEKIQNNWTYGEVLDENAKTHPMLRPYKTFSEKDKEIYRWPIKE
SIKAMLAWEWTLEKARDGEGEVEKKAATRKISQTAQATYDPSHGYSPQPIDISGMALSRE
LQSMAEQLAENYHNTWGRKKKLELQSKGGGTHPLLVPYDTLTAKEKARDREKAQDLLKFL
QLNGYAVTRGMKDMEQDISSIEKRFAYGFLQKLLKWMDIAQEFIAHLESEAVVSSGRVEK
SPHEQEIKFFAKILLPLVNQYFKNHCLYFLSTPAKVLGSGGHSSNKEKEMIASIFCKLAA
LVRHRVSLFGTDAGAVVNCLHILSRSLDARTVMKSGPEIVKAGLRQFFESAADDIEKMVE
NLKLGKVSSRNQVKGVSQNINYTTIALLPVLTSLFDHIAQHQFGDDVILDDLQISCYRIM
CSIYSLGTVKTPHAEKQRPALGECLAHLAAAMPVAFLEPVLNEFNMFSVYTTKTPRERTI
LGLPNQVEELCPDIPELEVLMKDIHDLAESGARYTEMPHVIEITLPMLCNYLPRWWERGL
ENFPEQEGQLCTSVTSEQLNQLLGSIMKIVVNNLGIDEASWMKRLAVFAQPIVSRAKPEM
LKSHFIPTMEKLKKRSGKVVAEEDHLRMEGKTEVDSENGTIRDEFAVLCRDLYALYPLLI
RYVDNNRARWLTNPDPDAEELFRMVGEVFIFWSKSHNFKREEQNFVVMNEINNMSFLTAD
SKSKMSKAGDGESGGSEQERTKKKRRGDRYSVQTSLIVAALKKLLPIGLNMCSPADQELI
NLAKIRYSLKDTDEEVREFLHNNLHLQGKVEDPAMRWQMSLYKEMAGKAEDAEDPEKVVK
RVQEVSAVLYHIEVTEHPFKSKKMVWHKLLSKQRRRAVVACFRMTPLYNIITHRATNMFL
DAYKRNWLETEGYSFQDKMIDDLSVSSDHSNEMSSRKERKPDPLHQLILHLSRTALTEKT
KLDVDHLYKNYAEIMAKACYITFSTGASSFERFQRSSSSSASQEKEMEIQRLLYQQSRLH
NRGAAEMVLQMISACKGEPGAMVSSTLKLGISILNGGNSDVQQKMLDYLKDKKDVGFFLS
VQSLMQTCSVLDLNAFERQNKAEGLGMVSEEGTSLSSTDSHEIPGLTVSLFGFLSPSFAL
HAAVQQNRLMHPDPGQRTGVRICVIFMPCHVFHLSKTLSHLHFLTLPKSLTATGNSFLLC
WCRFFRNACSNSTNVIVHAHLFVTLTELYFCFAVFFLTFLQDSSQIGLLKELLDLQKDMV
VMLLSLLEGNVVNGTIAKQMVDMLVESSSNVEMILKFFDMFLKLKDIVASDAFRDYVTDP
RGLISKKDFSKAMDSQKQYTPGEIQFLLSCSEADENEMINFEEFADRFQEPAKDIGFNIA
VLLTNLSEHVPHDTRLQNFLEQAESVLNYFRPFLGRIEIMGASRKIERIYFEISEANRNQ
WEMPQVRESKRQFIFDVVNEGGESEKMEMFVNFCEDTIFEMNIAASISEPEGDDGNGEEQ
APESTSAFADFIKSVVNFFNMFTFRNLRRRYRRFRKMTVKEMVIGLVTFVYTVLMGILMF
VYSICKGFFTLIWKVLFGGGLVESAKKMTVTDILASMPDPTQDEVHGELPPEPGSREVQD
TEGGADLLDPVGGEEEEEDSEEREGGRLPGFNTPGGLGDFGETTPEEPPTPEGTPLLKRK
LLSVSFMSSTENGEKAEKEPEPEPEPKEEEPAEKEEAAVKTKAKKSKKPVEEGFELWNEL
EIQRVKFMNYLSRNFYNLRFLALFIAFAVNFILLFYKVSDSPPGEEDFEGSGLFEGSGLF
EGSGAPEDGSGFDDGGEDDEEEGPLYYFLEESTGYMEPAMAFLSIVHTIISFLCIIGYNC
LKVPLVIFKREKELARKLEFDGLYVTEQPEDDDIKGQWDRLVLNTPTFPNNYWDKFVKRK
VLDKYGDIYGRERIAELLGMDLASLDVSAMTHEKKPEPDTSMFSWITSIDVKYQIWKFGV
VFTDNTFLYLVWYLLMSILGHYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLMMTVG
LLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIE
DPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICG
IGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFF
PAGDCFRKQYEDQLG
Download sequence
Identical sequences H3CFT0
99883.ENSTNIP00000007107 ENSTNIP00000007107 ENSTNIP00000007107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]