SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000007149 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000007149
Domain Number 1 Region: 149-457
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.83e-97
Family Protein kinases, catalytic subunit 0.00000000013
Further Details:      
 
Domain Number 2 Region: 2-113
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-21
Family Pleckstrin-homology domain (PH domain) 0.00000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000007149
Sequence length 482
Comment (Tetraodon nigroviridis)
Sequence
MNEASVVREGWLFKRGEYIKTWRPRYFILKSDGSFIGYKEKPEVCDHSLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTSVIERTFHVDSPEERLRKDWMRSLQAVANSLKCQQQDEE
RMEIKFGSPCDSSGSEDMEIAASKSRTKVTMSDFDYLKLLGKGTFGKVILVKEKATGMYY
AMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELF
FHLSRDRVFPEDRARFYGAEIVSALEYLHSCNVVYRDLKLENLMLDKDGHIKITDFGLCK
EGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERL
FELILMEEIRFPKSLAPEAKELLSGLLKKDPKQRLGGGPDDAKDVMSHRFFTSVNWQDVL
EKKLVPPFKPQMSETDTRYFDDEFTAQSITITPPDRYGSLEAKESDQRTHFPQFSYSASI
WE
Download sequence
Identical sequences H3CFX2
99883.ENSTNIP00000007149 ENSTNIP00000007149 ENSTNIP00000007149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]