SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000007455 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000007455
Domain Number 1 Region: 210-270
Classification Level Classification E-value
Superfamily BPTI-like 6.67e-22
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0019
Further Details:      
 
Domain Number 2 Region: 338-394
Classification Level Classification E-value
Superfamily BPTI-like 3.97e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0038
Further Details:      
 
Domain Number 3 Region: 284-321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000113
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 118-211
Classification Level Classification E-value
Superfamily PKD domain 0.0000000693
Family PKD domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000007455
Sequence length 476
Comment (Tetraodon nigroviridis)
Sequence
APPQAACSGAFRPGPEDFVLDSEDAVRGGAVLLDSAQVPSAEACQRACCERARCNLALLE
LRGRDAAGARNHTCVLFNCIHRNRFVCRFANQDGFRSFISNSASLRHLQGPTGGGGQAPP
IADAGPDLVVQPGTVVLLNGIESVPLGGAHITAYRWTLLRGNDSVSMEPTDLPDQVSVSG
LQAGSYTFQLTVTDSKQQSDAANVSVLVLSPQLSSTFCRAPVKVGPCRAAFPRWWFNAST
GQCQPFTFGGCKGNSNNYLTEEDCVSACRGVAGTGAQTTHGGVWSLCSPSQLSCGSGCCL
HKSLECDGVKHCSDGSDENHCSELNQTFSHLLEIEVDKKKARCSEPPYTGPCRASFPRWY
YNPMDMRCVRFTGGCGANGNNFEEESRCESSCSGITASGIQLLRAESADGRAASSSGHIA
LAVLLAVAILALLAVLSFCFLKSRRGRYRRSQAAGPAHVVLSEQDTLVYNRTTEPM
Download sequence
Identical sequences H3CGS7
ENSTNIP00000007455 99883.ENSTNIP00000007455 ENSTNIP00000007455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]