SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000007479 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000007479
Domain Number 1 Region: 3-196
Classification Level Classification E-value
Superfamily Sec7 domain 3.79e-75
Family Sec7 domain 0.0000000247
Further Details:      
 
Domain Number 2 Region: 204-325
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-32
Family Pleckstrin-homology domain (PH domain) 0.00000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000007479
Sequence length 343
Comment (Tetraodon nigroviridis)
Sequence
RKSMQRNQQMTIGRKKFNMDPKKGVGFLMDTSLLRRSSQEVAKFLYKGEGLNKTAIGEYL
GEREEFNVAVLHAFLELHQFTDLHLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCCCN
PGVFQSTDTCYVLSFAVIMLNTSLHNPNVKDKPSVQRFSAMNRGIDGGGDLPEPLLRSLY
DSIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGSGRVKTWRRRWFILTDSCLYYFEY
TTDKEPRGIIPLENLSIREVEDSKKPNCFELFIPDHKDQVIKACKTEADGRVVEGNHTFY
RISAPTAEEKDEWIGSIRAAISKDPFYEMLASRKKKVSSLKGP
Download sequence
Identical sequences H3CGV1
99883.ENSTNIP00000007479 ENSTNIP00000007479 ENSTNIP00000007479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]