SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000008280 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000008280
Domain Number 1 Region: 118-234
Classification Level Classification E-value
Superfamily EF-hand 1.14e-35
Family Osteonectin 0.017
Further Details:      
 
Domain Number 2 Region: 206-300
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.28e-27
Family Thyroglobulin type-1 domain 0.0008
Further Details:      
 
Domain Number 3 Region: 52-97
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000011
Family Ovomucoid domain III-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000008280
Sequence length 310
Comment (Tetraodon nigroviridis)
Sequence
AVDTTKDPCQNVKCSRHKVCVAQGYQRAMCVNRRKLEQKVQQPGQPEGHERSCKSCPVTV
PSPVCGSDGHNYASECKLEQQACLTGKDLSVMCTGFCPCAASTITESKRGGQSIKRNSCT
GQDLADLGDRLKDWFQLLHGNAKQNNSGRPGSGTSSALDRSLGASCKDSIGWMFSKLDTD
SDLYLGQAELTAINLDKYEICIRPFFNSCDTYKDGKISMAEWCLCFWRETEPPCLAELEK
IQVQGAAKMNPGMYIPSCDEDGYYRKVQCHQSRGECWCVDQHGGELMGSRIHGNPECDEV
AGYSGDFGSG
Download sequence
Identical sequences H3CJ51
ENSTNIP00000008280 ENSTNIP00000008280 99883.ENSTNIP00000008280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]