SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000008427 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000008427
Domain Number 1 Region: 121-341
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 7.72e-79
Family Fibrinogen C-terminal domain-like 0.00000075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000008427
Sequence length 343
Comment (Tetraodon nigroviridis)
Sequence
TLADKMKNLGIILLGVTLLLSAETRAQSPRKRPSPPKPPKAQCCNEVRSLKVQVANLTSL
LEELSRKQETDLMNVVRQIMELDKHNRQQEARVTEAESKYSEINNRVEIMQLQTLQSATQ
TSSDAIYDCASLYSKNYRISGEYKLPKDDFLGTSELSVYCDMETNGGGWTLIQRRKIGLT
SFNRDWKQYKSGFGSIRGDFWLGNDNIFRLTRQPSVLRIEMEDWEGQTRYAEYGFFTVTN
ELNSYKLFLANYSGNAGDSLHYHNNTNFSTADKDNDKCVDHCASLRKGGYWYNCCTDSNL
NGVFYRYGQHTKNSDGITWYGWHGSNYSLKRVEMKIRPADFQP
Download sequence
Identical sequences H3CJJ8
ENSTNIP00000008427 ENSTNIP00000008427 99883.ENSTNIP00000008427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]