SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000008714 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000008714
Domain Number 1 Region: 496-656
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-42
Family MAM domain 0.00061
Further Details:      
 
Domain Number 2 Region: 330-489
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-27
Family MAM domain 0.0024
Further Details:      
 
Domain Number 3 Region: 159-319
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-25
Family MAM domain 0.0017
Further Details:      
 
Domain Number 4 Region: 23-160
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.75e-18
Family MAM domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000008714
Sequence length 678
Comment (Tetraodon nigroviridis)
Sequence
HLLLTPLNDVRTATLTSASKVLAGSCSFERDTCGYSPAPELGGWSRNHKGRSILVDSASL
RGQEQAVLVSPVLERPGWSCVRLVYQISGRGSLQLHLRPQGDNFDYRLWWTREASDSWLI
ASVDLPNGTAPFQLLLEGGPGPGSSSRVEVFEILVVPGYCLECDFEEEHRCGYSNSWNPN
VNWYVGGSAAAGNQTDGQQRATLSPAPGQYMFVDSEHVRHFQEVAQLSSPMTTAPMAGCL
SFYYRDQQRGNVFSLFTRDQLGHYEEIWRPQVDATPGWTLVGVDIRAPHPLEVVFEVAFN
RAKGGYVAVDDISFSPEFCHSDTEPTVDPSVADCDFDTGLCLYHQERAESKGWSRVTVSP
NAYRMGDHTTGTGWFLQANVRSASTPGYVGRLHGPLLPGNQRYCVRFYYLLQASRKVDNA
LILYVYDEHDVAVEKVWSLSGSSGAVWTRVEVTFLKPMLTKLVFASICRNFWECGLVAID
DITVRLGDCRIAAGSLPGQCDFDDGLCGYRQDTVEDKGDWLPARGHTPTSYTGPRGDHTT
GVGSFLYIEASKMRPGHKARLLTSDLRGSSSPQCLVFHFHMYGSGSGILSVLLRQGGGQP
DSLLWRRRGEQGIGWMRATVDYRCGVRHQIVFEAIRGPSLRSDIAIDDVAFQPGPCEGEI
RSQSQSSSFSQDLLNQNS
Download sequence
Identical sequences H3CKD5
ENSTNIP00000022040 99883.ENSTNIP00000008714 ENSTNIP00000008714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]