SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000008735 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000008735
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.67e-26
Family Fibrinogen C-terminal domain-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000008735
Sequence length 68
Comment (Tetraodon nigroviridis)
Sequence
PSGPFKDCLQALEDGHTTSGMYLVKPENANRLMQVWCDQRHDPGGWTVIQRRVDGSVNFF
RNWETYKV
Download sequence
Identical sequences Q4SWS8
99883.ENSTNIP00000008735 ENSTNIP00000008735 ENSTNIP00000008735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]