SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000008810 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000008810
Domain Number 1 Region: 38-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.79e-40
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00048
Further Details:      
 
Domain Number 2 Region: 726-742,777-940
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-37
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 3 Region: 339-521
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.39e-35
Family Laminin G-like module 0.0044
Further Details:      
 
Domain Number 4 Region: 149-336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-31
Family Laminin G-like module 0.0088
Further Details:      
 
Domain Number 5 Region: 580-693
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000000279
Family Fibrinogen C-terminal domain-like 0.0043
Further Details:      
 
Domain Number 6 Region: 549-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000495
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000008810
Domain Number - Region: 986-1146
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00013
Family Laminin G-like module 0.054
Further Details:      
 
Domain Number - Region: 963-999
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00652
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000008810
Sequence length 1302
Comment (Tetraodon nigroviridis)
Sequence
SCPGATSVTIVLFLETCYLPLLCAPEACDSPLVSSLLPPSFRSSSQLSSSHGPVFAKVNR
REGAGGWSPLVSDRHQWLEVDLARRTQITAIATQGRYGSSDWLTSYMLMFSDTGHNWRQL
QKCHLCWVFPGNSNADTVVQYKLKNPEISRYLRLIPLDWNPTGRIGLRLEMYGCQYTSDV
ASFDGGAALIYRLTAWPKWSEKDIIALKFKTMKSSGTLLHAEGQRDHSLHLALDKGRLLL
YHQQGKGMSSFSGGRLLVSLGSLLDDFHWHTVKLERLNTHLNLTVDKNTHQVQVPDELIH
WDIHQLSLGAVQTHGLQKPILSSRNFLGCLENLIYNDLNLIDLAKKNNHQVSVMGNVTFS
CAERVSIAVTFTDAQSFLQLPGLTSWSSGILSLALQFRTWNKAGLLLTFELPQQKGSVWL
YLNDTRLRLQISKADGTHLELSAGSALNDGQWHSVELNSGQDHLSITVDKDEGATAQTSI
PLPLTANTQIFFGGCPNRKSTVECRNPFRGFLGCMRQLSLDQQPVDLIVVQQKLLGNYSC
LQIDTCGIIDRCSPSHCEHGGRCVQSWGTFHCNCSDSGYRGATCHSSIYEQSCEAYKHKG
NASGHYYIDVDGSGPIKPQLVYCNMTEERTWMVIQHNNTELTTIHMSPETKQHFIHFGYT
SGEQQLAAIFSQSEHCEQQLSHHCRKSRLFNTPEGTPFSWWVGGPAPGQVQDFWGGALPG
SRQCACGLQHNCLDSQHFCNCDADYEQWADDSGLVTHKESLPVRSLVLGDIQRTGSEVAY
MVGPLRCHGDKSFWNAAFFDKETSYLHFPTFHGELNADVSFLFKTTSSSGVFLENLGIKD
FIRLELKSSSEVIFSFDVGNGPLEVSVETNVPLNDNRWHSVQAERNIKEASLRVDKYPAA
TQRAPNDGHIHLQLNSQLFIGGTASRQKGFLGCIRSLQLNGVTLDLEERAKITPGVRPGC
PGHCSSYASLCRNNGQCVERTSGFSCSCAQSAYTGTFCHEEVSANFESSTSITYALKEPS
ELSLNHSASPFSLYSDVTEQSWNQSLPLHSQISTVYILELEWCSSSFTIVAGATLSEFDM
LRSFTSWIAILQIKFQESRTHHLQIHKVTLSAFFQIDGEVTEHFNLTSDTEFNSVKSLIV
GRVQGKNPDTMLNSKQHKCTCFGIFFCLSSTQQINTCAAILRHIHIHSTINTLSAGLYCL
SHLTLVGKLQPHTFQIEFIGNMQKLIRSIQFDVTIVSGVIAIVIFVIVGALAVMGRFICS
RKETYRNQDVKAAHSEDVHEFPFSSHTDLQNTPSENQKEHFI
Download sequence
Identical sequences H3CKN1
ENSTNIP00000008810 ENSTNIP00000008810 99883.ENSTNIP00000008810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]