SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000009261 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000009261
Domain Number 1 Region: 354-522
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.62e-49
Family SPRY domain 0.000043
Further Details:      
 
Domain Number 2 Region: 10-78
Classification Level Classification E-value
Superfamily RING/U-box 9.42e-18
Family RING finger domain, C3HC4 0.0056
Further Details:      
 
Domain Number 3 Region: 131-187
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000824
Family B-box zinc-binding domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000009261
Sequence length 531
Comment (Tetraodon nigroviridis)
Sequence
EAGALDLFSEQELTCSICLDLFDEPVSTPCGHNFCQACIGGYWASSAVCTCPLCKHQFDE
RPQLSVNKVFALIAHKFKETRAAAGEEVVWCDVCTGVKRPATSSCLTCTASYCAEHEQPH
RSTPFYAKHPLMDPREALRGRTCDLHRRLLEVYCRICQRCICAICVLEEHRTHKTVSVQT
ERLGKQKLVARTEQEMVNRIKDREMRVSQLKKKMEAAKSYADAERAELGHLLDEVSRSLD
RIRSQVLGDIDSQLDGVMSKGEGLVRRLEAELSLLSDRRATLEVQAINQDHIGFLQSYQE
ATAPLEENQQSEEEEDLSLHLQLAEVKIGLSEVRDKMEEDTRRRESTWPDQPTKDVTLNP
VTAYPFLILSDDRKQVKRGEKLQFFRNSQQRFDVWSCVMAKEGFSSGRHYWEVFVGDSKD
WKVGVVTEAAQRKGLFDMTPASGYYALWWSGSHLRALTTPPLAKVKAPLKLRQVGVFLDM
DEGQVTFYNIKSGSEIYSFARGREFTDRMFPLFGTGDKDVPLVLMTTQHHL
Download sequence
Identical sequences H3CLY1
ENSTNIP00000002808 99883.ENSTNIP00000009261 ENSTNIP00000009261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]