SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000009333 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000009333
Domain Number 1 Region: 39-269
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.32e-77
Family Calponin-homology domain, CH-domain 0.0000839
Further Details:      
 
Domain Number 2 Region: 1337-1448
Classification Level Classification E-value
Superfamily E set domains 9.34e-34
Family Filamin repeat (rod domain) 0.000013
Further Details:      
 
Domain Number 3 Region: 1526-1640
Classification Level Classification E-value
Superfamily E set domains 1e-32
Family Filamin repeat (rod domain) 0.0000274
Further Details:      
 
Domain Number 4 Region: 1068-1158
Classification Level Classification E-value
Superfamily E set domains 5.2e-31
Family Filamin repeat (rod domain) 0.00000692
Further Details:      
 
Domain Number 5 Region: 1439-1546
Classification Level Classification E-value
Superfamily E set domains 1.33e-30
Family Filamin repeat (rod domain) 0.0000268
Further Details:      
 
Domain Number 6 Region: 1246-1358
Classification Level Classification E-value
Superfamily E set domains 2.2e-30
Family Filamin repeat (rod domain) 0.00000992
Further Details:      
 
Domain Number 7 Region: 560-673
Classification Level Classification E-value
Superfamily E set domains 2.27e-30
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 8 Region: 1632-1737
Classification Level Classification E-value
Superfamily E set domains 4.94e-28
Family Filamin repeat (rod domain) 0.0000271
Further Details:      
 
Domain Number 9 Region: 2219-2314
Classification Level Classification E-value
Superfamily E set domains 2.67e-27
Family Filamin repeat (rod domain) 0.0000117
Further Details:      
 
Domain Number 10 Region: 473-581
Classification Level Classification E-value
Superfamily E set domains 3.14e-27
Family Filamin repeat (rod domain) 0.00093
Further Details:      
 
Domain Number 11 Region: 385-483
Classification Level Classification E-value
Superfamily E set domains 1.67e-26
Family Filamin repeat (rod domain) 0.00079
Further Details:      
 
Domain Number 12 Region: 2027-2125
Classification Level Classification E-value
Superfamily E set domains 2.32e-26
Family Filamin repeat (rod domain) 0.0000296
Further Details:      
 
Domain Number 13 Region: 754-878
Classification Level Classification E-value
Superfamily E set domains 5.34e-26
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 14 Region: 1853-1941
Classification Level Classification E-value
Superfamily E set domains 7.34e-26
Family Filamin repeat (rod domain) 0.0000203
Further Details:      
 
Domain Number 15 Region: 858-973
Classification Level Classification E-value
Superfamily E set domains 2.34e-25
Family Filamin repeat (rod domain) 0.00069
Further Details:      
 
Domain Number 16 Region: 2413-2505
Classification Level Classification E-value
Superfamily E set domains 1.6e-24
Family Filamin repeat (rod domain) 0.0000174
Further Details:      
 
Domain Number 17 Region: 2320-2411
Classification Level Classification E-value
Superfamily E set domains 2.94e-24
Family Filamin repeat (rod domain) 0.0000268
Further Details:      
 
Domain Number 18 Region: 679-774
Classification Level Classification E-value
Superfamily E set domains 3.27e-24
Family Filamin repeat (rod domain) 0.00067
Further Details:      
 
Domain Number 19 Region: 1161-1270
Classification Level Classification E-value
Superfamily E set domains 4.07e-24
Family Filamin repeat (rod domain) 0.0000426
Further Details:      
 
Domain Number 20 Region: 284-382
Classification Level Classification E-value
Superfamily E set domains 6.27e-24
Family Filamin repeat (rod domain) 0.00082
Further Details:      
 
Domain Number 21 Region: 2543-2633
Classification Level Classification E-value
Superfamily E set domains 1.4e-23
Family Filamin repeat (rod domain) 0.0000407
Further Details:      
 
Domain Number 22 Region: 985-1082
Classification Level Classification E-value
Superfamily E set domains 2.47e-21
Family Filamin repeat (rod domain) 0.0016
Further Details:      
 
Domain Number 23 Region: 1947-2046
Classification Level Classification E-value
Superfamily E set domains 4e-17
Family Filamin repeat (rod domain) 0.0000415
Further Details:      
 
Domain Number 24 Region: 1785-1862
Classification Level Classification E-value
Superfamily E set domains 2.74e-16
Family Filamin repeat (rod domain) 0.00018
Further Details:      
 
Domain Number 25 Region: 2142-2234
Classification Level Classification E-value
Superfamily E set domains 4.94e-16
Family Filamin repeat (rod domain) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000009333
Sequence length 2634
Comment (Tetraodon nigroviridis)
Sequence
KSWKHLQTLQEAAGSSSSSPGTELHSDSLEPSAMPATEKDLAEDAPWKKIQQNTFTRWIN
EHLKCVNKRIVDLQLDLGDGLRLIALLEVLSHKKMYRKYHPRPNFRQMKLENVSVALEFL
DKESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPTWEGEDQEAESKTPKQRLLGW
IQHKVPDLPITNFSRDWSNGKALGALVDSCAPGLCPDWESWDPVKPVENATEAMQLADDW
LGIPQVIAPEEIIDPSVDEQSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGPGIEPTG
NRVMRPAVFTVDTFSAGQGQVTVYLDHPDGSREEAQLKAEPNEGKKTHSVSYVPQVTGPH
RVTVLFAGQQIPKSPFEVNVDKALGDASKVTVKGPGVEPVGNVANKPTYFDICTAGAGTG
DVTAVIRDPQGRQNSVEVMMEDKGDGVYRCTYRPTQAGTHGVTVTFGGVGIPKSPFSVDV
GPACVPGACRALGRGLQSTGMRVNQDGDFRVDTRNAGSGDLRVLIKGPSGVEEPVKQISS
KDGVFYYEYHPSSPGKYSVSISWGGTQIPKSPFEVAVGEEAGPQQIRAWGPGLEGGVVGR
AAIFVVESVAAEVGVLGFAIEGPSQAKIECEDQDDGSCNVTYWPTEPGEYAVHVTCDNVD
IEHSPFMALIVPDNADSYPDRVQAFGPGVEKSGCLVDQRAEFTVSAKDAGRGPLKITAQD
AEGLPVEVKVTGKGDGLYSCCYTPAAPIKHTLALTWGGVSIPKSPFRVNVGKGSHPHMVK
VFGPGVETSGLKANEPTHFTVDCSGAGDGGDVSVGIKCDANMVGDREADVDFDIIPNAND
TFTVKYIPPAAGKMTVKVLFTDKEVPQSPFQVTVDPSHDASKVKAEGPGLARTGVESGKP
THFTVLTKGAGKAAVDVSFSSPVKDFDIIDNYDYSQTVKYTPAKQGELTIVVTFGGDPIS
KSPFTVGVAAPLDLNKVNVDNLDGRVEVNQEQEFVVDTKGAGGQGHLEVTLLSPNQRTVP
CRVEPQPGRADVRVVRYTPTEEGVHAINVTYDGHTVPGSPFPVDAQLPPDPSKVKASGPG
LKGGLVGSPAEFTIDTKGAGTGGLGLTVEGPTEAKIECSDNGDGTCSVSYLPTEPGEYLV
NILFEDVPIPGSPFRADIQMPFDPSKVVASGAGLKRAKVGEPSVLNVDCSRAGPGELSLE
AALDAGVQAKTEVLDNQDGTQTVTYVPLSSGMYTLLLRYGGRPVPGFPAKVMAHPAVDTS
GVRAFGPGLDGQAVFREATTDFTVDARSLTQNGGAHVKAEVRNPSGALTDCSVTDNADGT
YSVAYTPFENGLHSVQVLYDDTPVPKSPFQVSVREGCDPTRVVAAGPGLQKALSQKPNNF
NIITRGAGIGGVGITVEGPSESKMSCKDNKDGSCSVEYVPFSPGLYDINITYGGEHIPGS
PFRVPVTDVVDPSKVKVTGPGVGSGVRAKVPQTFTVDCRKAGVAPLAVDVTGPKGLREAV
EVTDGGDGQHLVSYTPTVEGPYAVAVKYAEEDVPRSPFRFRVLPTHDASKVRASGPGLTS
GVPASFPVEFNIDTKDAGQGQLSVLITDQDGKAKQPSIGDNGDGTYCVSYVPDRTGRYTI
VIKYGGDDIPASPYRVRAVATGDASKCTVTGPGLDPTVAIGEELGMVVNTKGAGKGKVTC
LVVQPDGSEVEAQVLENEDGTFDIFYTAPAPGNYVIYVRFGGENIPHSPFNVVASDEVPV
MQEQTPLQQRAAPLGGWFQPWVPTYPPPSVNGSGFRPFDVVIPFSFRKGEITGEVFMPSG
KSTQPTITDNLDGTVTVQYSPTEAGLHEMHIKYNGTHIPESPLQFYVNHANSPSMTAHGP
GLSYGVANRTATFTVFTEDASEGGLDLAIEGPSKAEINCVDHKDGTCSVSYLPTLPGDYS
IIVKYNQDHIPGSPFTARITGQDTQRLSQFKLGTAADFSLDINETDLSQLTARIQAPSGR
EEPCLLKRMANNHTGLSFIPREVGEHRVSIFKNGQHIANSPITIMVVQSEVGNASQVRAY
GDGLEQGTTFNNSSFIVDTQDAGYGGLALSVEGPSKVDIQTEDMEDRICKVSYCPTEPGN
YFVSIRFAEEHIPGSPFTVHVTGEGRVRESITRRQKAASVACVGSSCDLNLKIPAVDLKD
VRSEVLSPSGIVRPAELVAMGNDTYCVSFVPEMGVHSVSVTADGEHVPGSPFQFTVGPLG
EGGASKVRAGGQGLKGALAGEPAEFSIWTREAGAGGLAIAVEGPSRAEISFDDHKDGSCG
VSYVAQEPGDYEISVKFNEQHIPDSPFLVPVAAPANDARRLAVTGLQESGLKVNHPASFA
VHLNGAQGKMAAKVHSPSGALEECVVTELEQDKYAIRFIPRENGLHTIDVKFNGSHIPGS
PFQVRVGEPGQTGDPGLVSVYGTGLERGTTGAQSEFIINNTKAGPGALTVTIEGPSKVKM
ECQEVPEGYKVHYTPMAPGNYLISVKYGGPYHVSGSPFKAKVTGPRLVNVTNASETSTLT
LDPALRASSSSLTRSSAPAFASNASKVQSHGPGLSKAFVDQVNRFYVDCSNAGNNMLLVG
VHGPETPCEEVLVKHEGNLRYCVSYQLREAGSYSLVVKWGEDHIPGSPFHVTVA
Download sequence
Identical sequences H3CM53
ENSTNIP00000009333 99883.ENSTNIP00000009333 ENSTNIP00000009333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]