SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000009336 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000009336
Domain Number 1 Region: 280-434
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-37
Family SPRY domain 0.00046
Further Details:      
 
Domain Number 2 Region: 9-80
Classification Level Classification E-value
Superfamily RING/U-box 1.21e-21
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number 3 Region: 84-141
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000087
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000009336
Domain Number - Region: 130-236
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.00536
Family C-terminal domain of PLC-beta 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000009336
Sequence length 436
Comment (Tetraodon nigroviridis)
Sequence
LGEKMSFQPTEDLLCPICQDVFTDPVVLSCSHSFCRDCLQTWWAGKPSRECPLCNRRSSR
SDPPCNLALKNLCNAFLQQKSQASSGSQLCPLHCERLKLFCLEHQRPVCLICRDSKSHSN
HRFRPADEAARDHRAKLALFQHVKQNCDLMTEHVKLQAQYTQSQIQEQFRALYRFLREEE
EARITLLKEEEEQKMMVIKKHAEALSRAMKTLSDTVSATEEQLGEDHVRFLQLYNAAVKR
VQQHPLLEDPQLPPGALIDVGKHLGNLGFNVWTKMKNMVSYAPVILDPNTANPEFSLSDD
LTTVRHGHRQNLPENPERINCYRSVRGCEGISSGHHCWDMEVGDNAAWFVGMTEFVRWNK
EKTSRFWQVEFHSNKYSMRTVEQPPTPLRVKKKLQRIRVLLDWNRGKLSWSDPDTNTHIH
TVTHAFTDKLFPCIGT
Download sequence
Identical sequences H3CM56
ENSTNIP00000009336 ENSTNIP00000009336 99883.ENSTNIP00000009336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]