SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000009358 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000009358
Domain Number 1 Region: 348-608
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.33e-84
Family Eukaryotic proteases 0.0000000571
Further Details:      
 
Domain Number 2 Region: 107-201
Classification Level Classification E-value
Superfamily Kringle-like 2.42e-28
Family Kringle modules 0.00025
Further Details:      
 
Domain Number 3 Region: 206-308
Classification Level Classification E-value
Superfamily Kringle-like 1.3e-26
Family Kringle modules 0.00028
Further Details:      
 
Domain Number 4 Region: 42-96
Classification Level Classification E-value
Superfamily GLA-domain 6.73e-21
Family GLA-domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000009358
Sequence length 615
Comment (Tetraodon nigroviridis)
Sequence
MAEPTLKPLTVLLLFLLHSCLATQDVFLSSRSASQVLLRTRRANSWLEEVNAGNLERECM
EEICNYEEAREVFEQKDPTETFWKKYQDCKGYLPRTKQSIPPLKECIDGFCISGTGANYA
GNVNISKSGRQCQHWKHNFPHPIIREFNASKPGSILEENFCRNPNNSADGPWCFTTDPTV
QKETCRVPTCGEAFVPPTLAPTHIKSTACLSNYGTDYTGDLDVTAGGHPCLQWSSPEAKA
LSKDKEFIPEVRLLGNKCRNPDRDPEGPWCYVEVLGNVTVDYCDLELCEEFLSEDLPQDS
GAQQRTTLSSRKQFFNPRTFGQGENDCGQRPLFEKISKKDAKEDELLESYREKRIVGGDD
AEVASAPWQVMLYKRSPQELLCGASLISDEWVLTAAHCILYPPWNKNFSASDILVRLGKH
NRAKFERGIEKIMVIDRIIVHPKYNWKENLNRDIALLHLRLPVPFSDVIHPICLPNKNVA
RMLMTQGFKGRVTGWGNLKESYNPAARNLPTYLQQIHLPIVEEDVCRSSTSIRITDNMFC
AGYKPEDSQRGDACEGDSGGPFVMKHPEENRWYQMGIVSWGEGCDRDGKYGFYTHLFRMT
KWMRKVIDQSDDSDS
Download sequence
Identical sequences H3CM77
ENSTNIP00000009358 99883.ENSTNIP00000009358 ENSTNIP00000009358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]