SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000009452 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000009452
Domain Number 1 Region: 6-192
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-36
Family SPRY domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000009452
Sequence length 198
Comment (Tetraodon nigroviridis)
Sequence
EPTCRADLIKHWVNLTLDDKTANKMLWITEGGAKVARMTDSVTCPVLDRPERYEYVPQVL
CKEGILGFRGYWEVEFTGWVVLGVAYERAARRNSDGPCGFGENEESWGLGWSGSSYNAWH
KSQTMEILEVPLCSTLGVYLDQPAGLLNFYTVEEVKEGEEGAGGKEVKLLHQVKSSFLGK
MIPGFWLGTQSHCLIKKK
Download sequence
Identical sequences H3CMH1
99883.ENSTNIP00000009452 ENSTNIP00000009452 ENSTNIP00000009452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]