SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000009476 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000009476
Domain Number 1 Region: 18-255
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.36e-57
Family Ankyrin repeat 0.0000844
Further Details:      
 
Domain Number 2 Region: 268-313
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000249
Family SOCS box-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000009476
Sequence length 318
Comment (Tetraodon nigroviridis)
Sequence
MLNHHCRRNPELHEELQIQAAVAAGDVYTVRRMLEQGYSPKIRDANGWTLLHFSAAKGKE
RCVRVFLEHGADPTVKDFIGGFTALHYAAMHGRARIARLMLESDYRRDIINAKSNDGWTP
LHVAAHYGRDSFVRLLLEFRAEVDPLSDKGTTPLQLAIIRERSSCVRILLDHSANIDIQN
GFLLRYAVIKGNHSYCRMFLQRGADTNLGRLEDGQTPLHLSALRDDVLCAQMLYAYGADT
NTRNYEGQTPVALSVSMSGISRPCLDFLQEVTRQPRSLQDLCRIQIRHCIGLQSLKSLED
LPIAKVMIDYLKHKFDNL
Download sequence
Identical sequences Q4STS3
99883.ENSTNIP00000009476 ENSTNIP00000009476 ENSTNIP00000009476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]